KEGG   Homo sapiens (human): 1435Help
Entry
1435              CDS       T01001                                 

Gene name
CSF1, CSF-1, MCSF
Definition
colony stimulating factor 1 (macrophage) (EC:2.7.10.1)
Orthology
K05453  
macrophage colony-stimulating factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Osteoclast differentiation
Hematopoietic cell lineage
TNF signaling pathway
Rheumatoid arthritis
Drug target
Sunitinib: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    1435 (CSF1)
   04015 Rap1 signaling pathway
    1435 (CSF1)
   04668 TNF signaling pathway
    1435 (CSF1)
   04151 PI3K-Akt signaling pathway
    1435 (CSF1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1435 (CSF1)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    1435 (CSF1)
  Development
   04380 Osteoclast differentiation
    1435 (CSF1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    1435 (CSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3
AA seq 554 aa AA seqDB search
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
HERQSEGSSSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
SPLTQDDRQVELPV
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccgggcgccgccgggcgctgccctcccacgacatggctgggctccctgctg
ttgttggtctgtctcctggcgagcaggagtatcaccgaggaggtgtcggagtactgtagc
cacatgattgggagtggacacctgcagtctctgcagcggctgattgacagtcagatggag
acctcgtgccaaattacatttgagtttgtagaccaggaacagttgaaagatccagtgtgc
taccttaagaaggcatttctcctggtacaagacataatggaggacaccatgcgcttcaga
gataacacccccaatgccatcgccattgtgcagctgcaggaactctctttgaggctgaag
agctgcttcaccaaggattatgaagagcatgacaaggcctgcgtccgaactttctatgag
acacctctccagttgctggagaaggtcaagaatgtctttaatgaaacaaagaatctcctt
gacaaggactggaatattttcagcaagaactgcaacaacagctttgctgaatgctccagc
caagatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccatccctagcagt
gacccggcctctgtctcccctcatcagcccctcgccccctccatggcccctgtggctggc
ttgacctgggaggactctgagggaactgagggcagctccctcttgcctggtgagcagccc
ctgcacacagtggatccaggcagtgccaagcagcggccacccaggagcacctgccagagc
tttgagccgccagagaccccagttgtcaaggacagcaccatcggtggctcaccacagcct
cgcccctctgtcggggccttcaaccccgggatggaggatattcttgactctgcaatgggc
actaattgggtcccagaagaagcctctggagaggccagtgagattcccgtaccccaaggg
acagagctttccccctccaggccaggagggggcagcatgcagacagagcccgccagaccc
agcaacttcctctcagcatcttctccactccctgcatcagcaaagggccaacagccggca
gatgtaactggtaccgccttgcccagggtgggccccgtgaggcccactggccaggactgg
aatcacaccccccagaagacagaccatccatctgccctgctcagagaccccccggagcca
ggctctcccaggatctcatcactgcgcccccagggcctcagcaacccctccaccctctct
gctcagccacagctttccagaagccactcctcgggcagcgtgctgccccttggggagctg
gagggcaggaggagcaccagggatcggaggagccccgcagagccagaaggaggaccagca
agtgaaggggcagccaggcccctgccccgttttaactccgttcctttgactgacacaggc
catgagaggcagtccgagggatcctccagcccgcagctccaggagtctgtcttccacctg
ctggtgcccagtgtcatcctggtcttgctggccgtcggaggcctcttgttctacaggtgg
aggcggcggagccatcaagagcctcagagagcggattctcccttggagcaaccagagggc
agccccctgactcaggatgacagacaggtggaactgccagtgtag

DBGET integrated database retrieval system