KEGG   Homo sapiens (human): 1435Help
Entry
1435              CDS       T01001                                 

Gene name
CSF1, CSF-1, MCSF
Definition
colony stimulating factor 1 (macrophage) (EC:2.7.10.1)
Orthology
K05453  
macrophage colony-stimulating factor 1
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Osteoclast differentiation
Hematopoietic cell lineage
TNF signaling pathway
Rheumatoid arthritis
Drug target
Sunitinib: 
Other: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.3
AA seq 554 aa AA seqDB search
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
HERQSEGSSSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
SPLTQDDRQVELPV
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccgggcgccgccgggcgctgccctcccacgacatggctgggctccctgctg
ttgttggtctgtctcctggcgagcaggagtatcaccgaggaggtgtcggagtactgtagc
cacatgattgggagtggacacctgcagtctctgcagcggctgattgacagtcagatggag
acctcgtgccaaattacatttgagtttgtagaccaggaacagttgaaagatccagtgtgc
taccttaagaaggcatttctcctggtacaagacataatggaggacaccatgcgcttcaga
gataacacccccaatgccatcgccattgtgcagctgcaggaactctctttgaggctgaag
agctgcttcaccaaggattatgaagagcatgacaaggcctgcgtccgaactttctatgag
acacctctccagttgctggagaaggtcaagaatgtctttaatgaaacaaagaatctcctt
gacaaggactggaatattttcagcaagaactgcaacaacagctttgctgaatgctccagc
caagatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccatccctagcagt
gacccggcctctgtctcccctcatcagcccctcgccccctccatggcccctgtggctggc
ttgacctgggaggactctgagggaactgagggcagctccctcttgcctggtgagcagccc
ctgcacacagtggatccaggcagtgccaagcagcggccacccaggagcacctgccagagc
tttgagccgccagagaccccagttgtcaaggacagcaccatcggtggctcaccacagcct
cgcccctctgtcggggccttcaaccccgggatggaggatattcttgactctgcaatgggc
actaattgggtcccagaagaagcctctggagaggccagtgagattcccgtaccccaaggg
acagagctttccccctccaggccaggagggggcagcatgcagacagagcccgccagaccc
agcaacttcctctcagcatcttctccactccctgcatcagcaaagggccaacagccggca
gatgtaactggtaccgccttgcccagggtgggccccgtgaggcccactggccaggactgg
aatcacaccccccagaagacagaccatccatctgccctgctcagagaccccccggagcca
ggctctcccaggatctcatcactgcgcccccagggcctcagcaacccctccaccctctct
gctcagccacagctttccagaagccactcctcgggcagcgtgctgccccttggggagctg
gagggcaggaggagcaccagggatcggaggagccccgcagagccagaaggaggaccagca
agtgaaggggcagccaggcccctgccccgttttaactccgttcctttgactgacacaggc
catgagaggcagtccgagggatcctccagcccgcagctccaggagtctgtcttccacctg
ctggtgcccagtgtcatcctggtcttgctggccgtcggaggcctcttgttctacaggtgg
aggcggcggagccatcaagagcctcagagagcggattctcccttggagcaaccagagggc
agccccctgactcaggatgacagacaggtggaactgccagtgtag

DBGET integrated database retrieval system