KEGG   Homo sapiens (human): 143630Help
Entry
143630            CDS       T01001                                 

Gene name
UBQLNL
Definition
ubiquilin-like
Orthology
K04523  
ubiquilin
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    143630 (UBQLNL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 475 aa AA seqDB search
MWHAISRTSRMSQSGCPSGLLADKNISSSATRVIVKTAGNQKDFMVADDISVRQFKEMLL
AHFQCQMDQLVLVFMGCLLKDHDTLSQRGIMDGHTIYLVIKSKQGSRSLAHSFRDLPTND
PCHRDRNTKGNSSRVHQPTGMNQAPVELAHFVGSDAPKVHTQNLEVSHPECKAQMLENPS
IQRLLSNMEFMWQFISEHLDTQQLMQQNPEVSRLLLDNSEILLQTLELARNLAMIQEIMQ
IQQPSQNLEYPLNPQPYLGLETMPGGNNALGQNYADINDQMLNSMQDPFGGNPFTALLAG
QVLEQVQSSPPPPPPSQEQQDQLTQHPATRVIYNSSGGFSSNTSANDTLNKVNHTSKANT
AMISTKGQSHICATRQPAWIPALPSIELTQQLQEEYKDATVSLSSSRQTLKGDLQLSDEQ
SSSQITGGMMQLLMNNPYLAAQIMLFTSMPQLSEQWRQQLPTFLQQTQISDLLSA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtggcatgccatctctcgaacatccaggatgtcccagagtggatgtccatcaggtctg
ctggcagacaaaaatatctcttcaagtgccactcgagtgatagtgaagactgcaggcaac
cagaaagactttatggtagctgatgacatctcggtaaggcagttcaaggagatgctattg
gctcacttccaatgccagatggaccaactagtgctggtcttcatgggttgccttctcaaa
gaccatgacacactgagccagaggggcatcatggatggccacaccatctacttggtcatc
aagtccaagcagggctccagatctctagcccattccttccgggacctgccaacgaatgat
ccctgccaccgggacagaaacaccaaaggaaacagcagcagagtgcaccaaccaactggt
atgaatcaagctccagtggaactggcccactttgtggggtctgatgcacccaaagtgcat
acccaaaacttggaagtgagccacccagagtgcaaagcacagatgctggagaatcctagc
atccagcggcttctgtccaacatggagttcatgtggcagttcatttcagaacatctagac
acgcaacaattgatgcagcagaacccagaagtttcccgccttcttcttgataattctgag
atcctattgcagactctggagctggccaggaaccttgctatgatccaagagataatgcag
atccaacaaccttcacaaaaccttgagtatccactgaacccacagccatatctgggctta
gagacaatgccaggtgggaataatgccctgggtcagaactatgctgatatcaatgatcaa
atgctgaacagcatgcaagatccttttggaggaaaccctttcacagctctcctggcagga
caagtgctagaacaagtccagtcttcacccccacctccaccaccatcacaggaacaacaa
gaccagctcacacagcatcctgcaacccgagtcatctataatagctctggtggtttctct
tcaaacacctcagccaatgacacccttaacaaggtcaaccacacttccaaagccaacact
gctatgatttccaccaagggccagagccatatctgtgccactcggcagccagcttggata
ccagccttacctagcatagagcttacccagcagcttcaagaagaatacaaggatgccact
gtttctctaagtagctccagacagacattaaagggtgatctccagctgtcagatgagcag
agcagctcccagatcacaggaggcatgatgcagttgcttatgaacaacccctacctggca
gctcagattatgttgttcacaagtatgccccagctgagtgaacagtggaggcagcagctg
cccacattcctgcagcagacacagatttctgatctgcttagtgcttag

DBGET integrated database retrieval system