KEGG   Homo sapiens (human): 143630Help
Entry
143630            CDS       T01001                                 

Gene name
UBQLNL
Definition
(RefSeq) ubiquilin like
  KO
K22254  ubiquilin-like protein
Organism
hsa  Homo sapiens (human)
Brite
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    143630 (UBQLNL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin YukD Rad60-SLD
Motif
Other DBs
NCBI-GeneID: 143630
NCBI-ProteinID: NP_659490
HGNC: 28294
Ensembl: ENSG00000175518
Vega: OTTHUMG00000066903
Pharos: Q8IYU4(Tdark)
UniProt: Q8IYU4
Position
11p15.4
AA seq 475 aa AA seqDB search
MWHAISRTSRMSQSGCPSGLLADKNISSSATRVIVKTAGNQKDFMVADDISVRQFKEMLL
AHFQCQMDQLVLVFMGCLLKDHDTLSQRGIMDGHTIYLVIKSKQGSRSLAHSFRDLPTND
PCHRDRNTKGNSSRVHQPTGMNQAPVELAHFVGSDAPKVHTQNLEVSHPECKAQMLENPS
IQRLLSNMEFMWQFISEHLDTQQLMQQNPEVSRLLLDNSEILLQTLELARNLAMIQEIMQ
IQQPSQNLEYPLNPQPYLGLETMPGGNNALGQNYADINDQMLNSMQDPFGGNPFTALLAG
QVLEQVQSSPPPPPPSQEQQDQLTQHPATRVIYNSSGGFSSNTSANDTLNKVNHTSKANT
AMISTKGQSHICATRQPAWIPALPSIELTQQLQEEYKDATVSLSSSRQTLKGDLQLSDEQ
SSSQITGGMMQLLMNNPYLAAQIMLFTSMPQLSEQWRQQLPTFLQQTQISDLLSA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtggcatgccatctctcgaacatccaggatgtcccagagtggatgtccatcaggtctg
ctggcagacaaaaatatctcttcaagtgccactcgagtgatagtgaagactgcaggcaac
cagaaagactttatggtagctgatgacatctcggtaaggcagttcaaggagatgctattg
gctcacttccaatgccagatggaccaactagtgctggtcttcatgggttgccttctcaaa
gaccatgacacactgagccagaggggcatcatggatggccacaccatctacttggtcatc
aagtccaagcagggctccagatctctagcccattccttccgggacctgccaacgaatgat
ccctgccaccgggacagaaacaccaaaggaaacagcagcagagtgcaccaaccaactggt
atgaatcaagctccagtggaactggcccactttgtggggtctgatgcacccaaagtgcat
acccaaaacttggaagtgagccacccagagtgcaaagcacagatgctggagaatcctagc
atccagcggcttctgtccaacatggagttcatgtggcagttcatttcagaacatctagac
acgcaacaattgatgcagcagaacccagaagtttcccgccttcttcttgataattctgag
atcctattgcagactctggagctggccaggaaccttgctatgatccaagagataatgcag
atccaacaaccttcacaaaaccttgagtatccactgaacccacagccatatctgggctta
gagacaatgccaggtgggaataatgccctgggtcagaactatgctgatatcaatgatcaa
atgctgaacagcatgcaagatccttttggaggaaaccctttcacagctctcctggcagga
caagtgctagaacaagtccagtcttcacccccacctccaccaccatcacaggaacaacaa
gaccagctcacacagcatcctgcaacccgagtcatctataatagctctggtggtttctct
tcaaacacctcagccaatgacacccttaacaaggtcaaccacacttccaaagccaacact
gctatgatttccaccaagggccagagccatatctgtgccactcggcagccagcttggata
ccagccttacctagcatagagcttacccagcagcttcaagaagaatacaaggatgccact
gtttctctaagtagctccagacagacattaaagggtgatctccagctgtcagatgagcag
agcagctcccagatcacaggaggcatgatgcagttgcttatgaacaacccctacctggca
gctcagattatgttgttcacaagtatgccccagctgagtgaacagtggaggcagcagctg
cccacattcctgcagcagacacagatttctgatctgcttagtgcttag

DBGET integrated database retrieval system