KEGG   Homo sapiens (human): 143686Help
Entry
143686            CDS       T01001                                 

Gene name
SESN3, SEST3
Definition
(RefSeq) sestrin 3
  KO
K10141  
sestrin
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    143686 (SESN3)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    143686 (SESN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q21
AA seq 492 aa AA seqDB search
MNRGGGSPSAAANYLLCTNCRKVLRKDKRIRVSQPLTRGPSAFIPEKEVVQANTVDERTN
FLVEEYSTSGRLDNITQVMSLHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQ
CSYLINMHVDEFLKTGGIAEWLNGLEYVPQRLKNLNEINKLLAHRPWLITKEHIQKLVKT
GENNWSLPELVHAVVLLAHYHALASFVFGSGINPERDPEISNGFRLISVNNFCVCDLAND
NNIENASLSGSNFGIVDSLSELEALMERMKRLQEEREDEEASQEEMSTRFEKEKKESLFV
VSGDTFHSFPHSDFEDDMIITSDVSRYIEDPGFGYEDFARRGEEHLPTFRAQDYTWENHG
FSLVNRLYSDIGHLLDEKFRMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMFGIRYDDY
DYGEVNQLLERSLKVYIKTVTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAEL
LYALRAITRHLT
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggggcggcggcagcccgtcggccgccgccaactacctgctctgtaccaactgc
cggaaagtgctgcggaaggataaaagaatcagagtgtctcaacccttgacaagaggacca
agtgcctttattccagagaaggaagttgtccaagcaaacacagtggatgaacgtactaac
tttcttgtggaagaatactctacatccggtcgtctggacaacatcacacaggtcatgagt
ttacacactcagtacctggagtctttcttgcggagccagttttacatgttgcgcatggat
ggtccccttcctctaccatacaggcactatattgcaataatggctgcagctagacatcag
tgttcttacttaataaacatgcatgtggatgaatttttaaagactggaggtattgctgag
tggttgaatggtttggaatatgtgccacaaagactgaaaaatcttaatgaaattaataag
ctgctagcacatcgaccttggctgatcacaaaagagcacattcagaaacttgtcaaaact
ggagaaaataattggtctctgcctgaactggtacatgctgtggtcctcctggcacattat
catgctttggcaagctttgtttttggtagtggtatcaatccagagagagatccagaaatc
tccaatggattcaggctaatatcagtcaacaatttctgcgtttgtgatcttgctaatgac
aacaacatagagaatgcatctctttcaggcagcaactttgggattgtggattctctaagt
gagctagaggccttaatggaaaggatgaaaagacttcaagaagaaagggaagatgaagag
gcgtctcaagaagaaatgagcactcgttttgaaaaggagaagaaagaaagtctttttgtg
gtctctggagatacttttcattcatttcctcattcagattttgaggatgacatgattata
acatctgatgtctctcgatatattgaagaccctggttttgggtatgaagactttgccaga
cgaggagaagagcatttgccaacattccgagctcaggactatacctgggaaaatcatggg
ttctccctggtgaacagactttattctgacattggacatcttcttgatgaaaagtttcgg
atggtctacaatctcacatataacactatggccacccatgaggatgttgacacaaccatg
ctgcgcagagctttatttaactatgttcactgtatgtttggaatcaggtatgatgactat
gattatggagaagttaatcaattacttgaaagaagcctgaaggtttacattaagacagtg
acctgctatcctgagagaactacaaaacgcatgtatgatagttactggcggcagttcaaa
cactcagaaaaagttcatgtcaatctacttttaatggaagcacgaatgcaagctgaactt
ctttatgctcttcgtgccataactcggcatttgacctga

DBGET integrated database retrieval system