KEGG   Homo sapiens (human): 143686Help
Entry
143686            CDS       T01001                                 

Gene name
SESN3, SEST3
Definition
sestrin 3
Orthology
K10141  
sestrin
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    143686 (SESN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q21
AA seq 353 aa AA seqDB search
MSLHTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMKLVKTGENNWSLPELVHAVVLLAH
YHALASFVFGSGINPERDPEISNGFRLISVNNFCVCDLANDNNIENASLSGSNFGIVDSL
SELEALMERMKRLQEEREDEEASQEEMSTRFEKEKKESLFVVSGDTFHSFPHSDFEDDMI
ITSDVSRYIEDPGFGYEDFARRGEEHLPTFRAQDYTWENHGFSLVNRLYSDIGHLLDEKF
RMVYNLTYNTMATHEDVDTTMLRRALFNYVHCMFGIRYDDYDYGEVNQLLERSLKVYIKT
VTCYPERTTKRMYDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITRHLT
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagtttacacactcagtacctggagtctttcttgcggagccagttttacatgttgcgc
atggatggtccccttcctctaccatacaggcactatattgcaataatgaaacttgtcaaa
actggagaaaataattggtctctgcctgaactggtacatgctgtggtcctcctggcacat
tatcatgctttggcaagctttgtttttggtagtggtatcaatccagagagagatccagaa
atctccaatggattcaggctaatatcagtcaacaatttctgcgtttgtgatcttgctaat
gacaacaacatagagaatgcatctctttcaggcagcaactttgggattgtggattctcta
agtgagctagaggccttaatggaaaggatgaaaagacttcaagaagaaagggaagatgaa
gaggcgtctcaagaagaaatgagcactcgttttgaaaaggagaagaaagaaagtcttttt
gtggtctctggagatacttttcattcatttcctcattcagattttgaggatgacatgatt
ataacatctgatgtctctcgatatattgaagaccctggttttgggtatgaagactttgcc
agacgaggagaagagcatttgccaacattccgagctcaggactatacctgggaaaatcat
gggttctccctggtgaacagactttattctgacattggacatcttcttgatgaaaagttt
cggatggtctacaatctcacatataacactatggccacccatgaggatgttgacacaacc
atgctgcgcagagctttatttaactatgttcactgtatgtttggaatcaggtatgatgac
tatgattatggagaagttaatcaattacttgaaagaagcctgaaggtttacattaagaca
gtgacctgctatcctgagagaactacaaaacgcatgtatgatagttactggcggcagttc
aaacactcagaaaaagttcatgtcaatctacttttaatggaagcacgaatgcaagctgaa
cttctttatgctcttcgtgccataactcggcatttgacctga

DBGET integrated database retrieval system