KEGG   Homo sapiens (human): 1439Help
Entry
1439              CDS       T01001                                 

Gene name
CSF2RB, CD131, CDw131, IL3RB, IL5RB, SMDP5
Definition
colony stimulating factor 2 receptor, beta, low-affinity (granulocyte-macrophage)
Orthology
K04738  
cytokine receptor common subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Apoptosis
Jak-STAT signaling pathway
Drug target
Molgramostim: 
Sargramostim: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    1439 (CSF2RB)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1439 (CSF2RB)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    1439 (CSF2RB)
Cellular antigens [BR:hsa04090]
 Proteins
  1439 (CSF2RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.1
AA seq 897 aa AA seqDB search
MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLG
TRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQD
SWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
HTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWET
MKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTG
YNGIWSEWSEARSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPN
PSKSHLFQNGSAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIE
DPKHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSR
SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGPGQAVEVERRPSQ
GAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSGDTEDPGVASGYVSSADLVFT
PNSGASSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELPPIEGRSPRSP
RNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPS
SPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggcccaggggctgctctccatggccctgctggccctgtgctgggagcgcagc
ctggcaggggcagaagaaaccatcccgctgcagaccctgcgctgctacaacgactacacc
agccacatcacctgcaggtgggcagacacccaggatgcccagcggctcgtcaacgtgacc
ctcattcgccgggtgaatgaggacctcctggagccagtgtcctgtgacctcagtgatgac
atgccctggtcagcctgcccccatccccgctgcgtgcccaggagatgtgtcattccctgc
cagagttttgtcgtcactgacgttgactacttctcattccaaccagacaggcctctgggc
acccggctcaccgtcactctgacccagcatgtccagcctcctgagcccagggacctgcag
atcagcaccgaccaggaccacttcctgctgacctggagtgtggcccttgggagtccccag
agccactggttgtccccaggggatctggagtttgaggtggtctacaagcggcttcaggac
tcttgggaggacgcagccatcctcctctccaacacctcccaggccaccctggggccagag
cacctcatgcccagcagcacctacgtggcccgagtacggacccgcctggccccaggttct
cggctctcaggacgtcccagcaagtggagcccagaggtttgctgggactcccagccaggg
gatgaggcccagccccagaacctggagtgcttctttgacggggccgccgtgctcagctgc
tcctgggaggtgaggaaggaggtggccagctcggtctcctttggcctattctacaagccc
agcccagatgcaggggaggaagagtgctccccagtgctgagggaggggctcggcagcctc
cacaccaggcaccactgccagattcccgtgcccgaccccgcgacccacggccaatacatc
gtctctgttcagccaaggagggcagagaaacacataaagagctcagtgaacatccagatg
gcccctccatccctcaacgtgaccaaggatggagacagctacagcctgcgctgggaaaca
atgaaaatgcgatacgaacacatagaccacacatttgagatccagtacaggaaagacacg
gccacgtggaaggacagcaagaccgagaccctccagaacgcccacagcatggccctgcca
gccctggagccctccaccaggtactgggccagggtgagggtcaggacctcccgcaccggc
tacaacgggatctggagcgagtggagtgaggcgcgctcctgggacaccgagtcggtgctg
cctatgtgggtgctggccctcatcgtgatcttcctcaccatcgctgtgctcctggccctc
cgcttctgtggcatctacgggtacaggctgcgcagaaagtgggaggagaagatccccaac
cccagcaagagccacctgttccagaacgggagcgcagagctttggcccccaggcagcatg
tcggccttcactagcgggagtcccccacaccaggggccgtggggcagccgcttccctgag
ctggagggggtgttccctgtaggattcggggacagcgaggtgtcacctctcaccatagag
gaccccaagcatgtctgtgatccaccatctgggcctgacacgactccagctgcctcagat
ctacccacagagcagccccccagcccccagccaggcccgcctgccgcctcccacacacct
gagaaacaggcttccagctttgacttcaatgggccctacctggggccgccccacagccgc
tccctacctgacatcctgggccagccggagcccccacaggagggtgggagccagaagtcc
ccacctccagggtccctggagtacctgtgtctgcctgctggggggcaggtgcaactggtc
cctctggcccaggcgatgggaccaggacaggccgtggaagtggagagaaggccgagccag
ggggctgcagggagtccctccctggagtccgggggaggccctgcccctcctgctcttggg
ccaagggtgggaggacaggaccaaaaggacagccctgtggctatacccatgagctctggg
gacactgaggaccctggagtggcctctggttatgtctcctctgcagacctggtattcacc
ccaaactcaggggcctcgtctgtctccctagttccctctctgggcctcccctcagaccag
acccccagcttatgtcctgggctggccagtggaccccctggagccccaggccctgtgaag
tcagggtttgagggctatgtggagctccctccaattgagggccggtcccccaggtcacca
aggaacaatcctgtcccccctgaggccaaaagccctgtcctgaacccaggggaacgcccg
gcagatgtgtccccaacatccccacagcccgagggcctccttgtcctgcagcaagtgggc
gactattgcttcctccccggcctggggcccggccctctctcgctccggagtaaaccttct
tccccgggacccggtcctgagatcaagaacctagaccaggcttttcaagtcaagaagccc
ccaggccaggctgtgccccaggtgcccgtcattcagctcttcaaagccctgaagcagcag
gactacctgtctctgcccccttgggaggtcaacaagcctggggaggtgtgttga

DBGET integrated database retrieval system