KEGG   Homo sapiens (human): 1441Help
Entry
1441              CDS       T01001                                 

Gene name
CSF3R, CD114, GCSFR
Definition
colony stimulating factor 3 receptor (granulocyte)
Orthology
K05061  
granulocyte colony-stimulating factor receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Hematopoietic cell lineage
Pathways in cancer
Drug target
Filgrastim: 
Lenograstim: 
Pegfilgrastim: 
Lipegfilgrastim: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    1441 (CSF3R)
   04151 PI3K-Akt signaling pathway
    1441 (CSF3R)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1441 (CSF3R)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    1441 (CSF3R)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1441 (CSF3R)
Cellular antigens [BR:hsa04090]
 Proteins
  1441 (CSF3R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p35-p34.3
AA seq 836 aa AA seqDB search
MARLGNCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQ
ILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAG
YPPAIPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPK
DGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDPSPE
AAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQYELCGLLPA
TAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVP
LEEDSGRIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRME
QNGRATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGK
TWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHL
MAASQAGATNSTVLTLMTLTPEGSELHIILGLFGLLLLLTCLCGTAWLCCSPNRKNPLWP
SVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLEEDEKKPVPWESHNSSETCGL
PTLVQTYVLQGDPRAVSTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRCDSTQPLLAGL
TPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLNFPLLQGIRVHGMEALGSF
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggctgggaaactgcagcctgacttgggctgccctgatcatcctgctgctcccc
ggaagtctggaggagtgcgggcacatcagtgtctcagcccccatcgtccacctgggggat
cccatcacagcctcctgcatcatcaagcagaactgcagccatctggacccggagccacag
attctgtggagactgggagcagagcttcagcccgggggcaggcagcagcgtctgtctgat
gggacccaggaatctatcatcaccctgccccacctcaaccacactcaggcctttctctcc
tgctgcctgaactggggcaacagcctgcagatcctggaccaggttgagctgcgcgcaggc
taccctccagccataccccacaacctctcctgcctcatgaacctcacaaccagcagcctc
atctgccagtgggagccaggacctgagacccacctacccaccagcttcactctgaagagt
ttcaagagccggggcaactgtcagacccaaggggactccatcctggactgcgtgcccaag
gacgggcagagccactgctgcatcccacgcaaacacctgctgttgtaccagaatatgggc
atctgggtgcaggcagagaatgcgctggggaccagcatgtccccacaactgtgtcttgat
cccatggatgttgtgaaactggagccccccatgctgcggaccatggaccccagccctgaa
gcggcccctccccaggcaggctgcctacagctgtgctgggagccatggcagccaggcctg
cacataaatcagaagtgtgagctgcgccacaagccgcagcgtggagaagccagctgggca
ctggtgggccccctccccttggaggcccttcagtatgagctctgcgggctcctcccagcc
acggcctacaccctgcagatacgctgcatccgctggcccctgcctggccactggagcgac
tggagccccagcctggagctgagaactaccgaacgggcccccactgtcagactggacaca
tggtggcggcagaggcagctggaccccaggacagtgcagctgttctggaagccagtgccc
ctggaggaagacagcggacggatccaaggttatgtggtttcttggagaccctcaggccag
gctggggccatcctgcccctctgcaacaccacagagctcagctgcaccttccacctgcct
tcagaagcccaggaggtggcccttgtggcctataactcagccgggacctctcgtcccact
ccggtggtcttctcagaaagcagaggcccagctctgaccagactccatgccatggcccga
gaccctcacagcctctgggtaggctgggagccccccaatccatggcctcagggctatgtg
attgagtggggcctgggcccccccagcgcgagcaatagcaacaagacctggaggatggaa
cagaatgggagagccacggggtttctgctgaaggagaacatcaggccctttcagctctat
gagatcatcgtgactcccttgtaccaggacaccatgggaccctcccagcatgtctatgcc
tactctcaagaaatggctccctcccatgccccagagctgcatctaaagcacattggcaag
acctgggcacagctggagtgggtgcctgagccccctgagctggggaagagcccccttacc
cactacaccatcttctggaccaacgctcagaaccagtccttctccgccatcctgaatgcc
tcctcccgtggctttgtcctccatggcctggagcccgccagtctgtatcacatccacctc
atggctgccagccaggctggggccaccaacagtacagtcctcaccctgatgaccttgacc
ccagaggggtcggagctacacatcatcctgggcctgttcggcctcctgctgttgctcacc
tgcctctgtggaactgcctggctctgttgcagccccaacaggaagaatcccctctggcca
agtgtcccagacccagctcacagcagcctgggctcctgggtgcccacaatcatggaggag
gatgccttccagctgcccggccttggcacgccacccatcaccaagctcacagtgctggag
gaggatgaaaagaagccggtgccctgggagtcccataacagctcagagacctgtggcctc
cccactctggtccagacctatgtgctccagggggacccaagagcagtttccacccagccc
caatcccagtctggcaccagcgatcaggtcctttatgggcagctgctgggcagccccaca
agcccagggccagggcactatctccgctgtgactccactcagcccctcttggcgggcctc
acccccagccccaagtcctatgagaacctctggttccaggccagccccttggggaccctg
gtaaccccagccccaagccaggaggacgactgtgtctttgggccactgctcaacttcccc
ctcctgcaggggatccgggtccatgggatggaggcgctggggagcttctag

DBGET integrated database retrieval system