KEGG   Homo sapiens (human): 144124Help
Entry
144124            CDS       T01001                                 

Gene name
OR10A5, JCG6, OR10A1, OR11-403
Definition
(RefSeq) olfactory receptor family 10 subfamily A member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    144124 (OR10A5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    144124 (OR10A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 Myc_target_1
Motif
Other DBs
NCBI-GeneID: 144124
NCBI-ProteinID: NP_835462
OMIM: 608493
HGNC: 15131
Ensembl: ENSG00000166363
Vega: OTTHUMG00000165738
Pharos: Q9H207(Tdark)
UniProt: Q9H207 A0A126GWR0
Position
11p15.4
AA seq 317 aa AA seqDB search
MAIGNWTEISEFILMSFSSLPTEIQSLLFLTFLTIYLVTLKGNSLIILVTLADPMLHSPM
YFFLRNLSFLEIGFNLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMA
YDRYVAICSPLHYPVIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFC
DSPPVLKLVCADTALFEIYAIVGTILVVMIPCLLILCSYTRIAAAILKIPSAKGKHKAFS
TCSSHLLVVSLFYISSSLTYFWPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNSEVKN
ALSRTFHKVLALRNCIP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctataggaaactggacagaaataagtgaatttatcctcatgagcttctcttcccta
cctactgaaatacagtcattgctcttcctgacatttctaactatctatttggttactctg
aagggaaacagcctcatcattctggttaccctagctgaccccatgctacacagccccatg
tacttcttcctcagaaacttatctttcctggagattggcttcaacctagtcattgtgccc
aaaatgctggggaccctgcttgcccaggacacaaccatctccttccttggctgtgccact
cagatgtatttcttcttcttctttggggtagctgaatgcttcctcctggctaccatggca
tatgaccgctatgtggccatctgcagtcccttgcactacccagtcatcatgaaccaaagg
acacgggccaaactggctgctgcttcctggttcccaggctttcctgtagctactgtgcag
accacatggctcttcagttttccattctgtggcaccaacaaggtgaaccacttcttctgt
gacagcccgcctgtgctgaagctggtctgtgcagacacagcactgtttgagatctacgcc
atcgtcggaaccattctggtggtcatgatcccctgcttgctgatcttgtgttcctatact
cgcattgctgctgctatcctcaagatcccatcagctaaagggaagcataaagccttctct
acgtgctcctcacacctccttgttgtctctcttttctatatatcttctagcctcacctac
ttctggcctaaatcaaataattctcctgagagcaagaagttgttatcattatcctacact
gttgtgactcccatgttgaaccccattatctacagcttgagaaatagcgaggtgaagaat
gccctcagcaggaccttccacaaggtcctagccctcagaaactgtatcccatag

DBGET integrated database retrieval system