KEGG   Homo sapiens (human): 144124Help
Entry
144124            CDS       T01001                                 

Gene name
OR10A5, JCG6, OR10A1, OR11-403
Definition
olfactory receptor, family 10, subfamily A, member 5
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    144124 (OR10A5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    144124 (OR10A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 317 aa AA seqDB search
MAIGNWTEISEFILMSFSSLPTEIQSLLFLTFLTIYLVTLKGNSLIILVTLADPMLHSPM
YFFLRNLSFLEIGFNLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMA
YDRYVAICSPLHYPVIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFC
DSPPVLKLVCADTALFEIYAIVGTILVVMIPCLLILCSYTRIAAAILKIPSAKGKHKAFS
TCSSHLLVVSLFYISSSLTYFWPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNSEVKN
ALSRTFHKVLALRNCIP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggctataggaaactggacagaaataagtgaatttatcctcatgagcttctcttcccta
cctactgaaatacagtcattgctcttcctgacatttctaactatctatttggttactctg
aagggaaacagcctcatcattctggttaccctagctgaccccatgctacacagccccatg
tacttcttcctcagaaacttatctttcctggagattggcttcaacctagtcattgtgccc
aaaatgctggggaccctgcttgcccaggacacaaccatctccttccttggctgtgccact
cagatgtatttcttcttcttctttggggtagctgaatgcttcctcctggctaccatggca
tatgaccgctatgtggccatctgcagtcccttgcactacccagtcatcatgaaccaaagg
acacgggccaaactggctgctgcttcctggttcccaggctttcctgtagctactgtgcag
accacatggctcttcagttttccattctgtggcaccaacaaggtgaaccacttcttctgt
gacagcccgcctgtgctgaagctggtctgtgcagacacagcactgtttgagatctacgcc
atcgtcggaaccattctggtggtcatgatcccctgcttgctgatcttgtgttcctatact
cgcattgctgctgctatcctcaagatcccatcagctaaagggaagcataaagccttctct
acgtgctcctcacacctccttgttgtctctcttttctatatatcttctagcctcacctac
ttctggcctaaatcaaataattctcctgagagcaagaagttgttatcattatcctacact
gttgtgactcccatgttgaaccccattatctacagcttgagaaatagcgaggtgaagaat
gccctcagcaggaccttccacaaggtcctagccctcagaaactgtatcccatag

DBGET integrated database retrieval system