KEGG   Homo sapiens (human): 144193Help
Entry
144193            CDS       T01001                                 

Gene name
AMDHD1
Definition
amidohydrolase domain containing 1 (EC:3.5.2.7)
Orthology
K01468  
imidazolonepropionase [EC:3.5.2.7]
Organism
hsa  Homo sapiens (human)
Pathway
Histidine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hsa00340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q23.1
AA seq 426 aa AA seqDB search
MASGHSLLLENAQQVVLVCARGERFLARDALRSLAVLEGASLVVGKDGFIKAIGPADVIQ
RQFSGETFEEIIDCSGKCILPGLVDAHTHPVWAGERVHEFAMKLAGATYMEIHQAGGGIH
FTVERTRQATEEELFRSLQQRLQCMMRAGTTLVECKSGYGLDLETELKMLRVIERARREL
DIGISATYCGAHSVPKGKTATEAADDIINNHLPKLKELGRNGEIHVDNIDVFCEKGVFDL
DSTRRILQRGKDIGLQINFHGDELHPMKAAELGAELGAQAISHLEEVSDEGIVAMATARC
SAILLPTTAYMLRLKQPRARKMLDEGVIVALGSDFNPNAYCFSMPMVMHLACVNMRMSMP
EALAAATINAAYALGKSHTHGSLEVGKQGDLIIINSSRWEHLIYQFGGHHELIEYVIAKG
KLIYKT
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcggccacagcctcctgctggagaacgcgcagcaagtggtgctggtgtgcgcc
cgcggcgagcgcttcctggcgcgggatgcgctgcgcagcctggcggtgctggaaggcgcc
agcctggtggtgggcaaagatggatttataaaagctattggtcctgctgatgttattcaa
agacagttttctggagaaacttttgaagaaataattgactgctctgggaaatgtattcta
ccaggtttggtggatgcacacacacatccagtatgggctggtgaaagagttcacgaattt
gcaatgaagttggcaggagccacctacatggaaattcaccaggccggaggagggatccac
tttaccgtggagcgcacgcgccaagccacagaggaggagctgttccgctccttgcagcaa
cggctccagtgcatgatgagggctggcaccacgctggtggagtgcaagagtggatatggc
ctcgacctggagaccgagctcaagatgctgcgcgtgattgagcgcgcccggcgggagctg
gacatcggcatctcggctacctactgcggggctcattcagtgcctaaaggaaaaactgct
actgaagctgctgatgacatcatcaataaccacctcccaaagctgaaggaacttggcaga
aatggggaaatacacgtggacaatatagacgtattttgtgagaaaggtgtctttgatctc
gattccaccagaaggattcttcaacgtggaaaagatatagggttacagattaacttccat
ggggatgaactccacccgatgaaggctgctgagcttggggctgaactgggagcgcaggca
atcagccacctggaagaagtgagtgatgaaggcatcgttgccatggcaacggccaggtgc
tctgccatccttctgcccaccacagcctacatgctgagactgaaacaacctcgagccagg
aagatgttagatgaaggagtaatagttgctctgggaagtgatttcaaccccaatgcatat
tgcttttcaatgccaatggtcatgcatctggcctgtgtaaacatgagaatgtccatgcct
gaggccttggccgctgccaccatcaatgcagcttatgcactgggaaagtctcacacacac
ggatcgttggaagttggcaaacagggagatctcattatcatcaattcatcccgatgggag
catttgatttaccagttcggaggccatcatgaattaattgaatatgttatagctaaagga
aaactcatctataaaacatga

DBGET integrated database retrieval system