KEGG   Homo sapiens (human): 144193Help
Entry
144193            CDS       T01001                                 

Gene name
AMDHD1, HMFT1272
Definition
(RefSeq) amidohydrolase domain containing 1
  KO
K01468  imidazolonepropionase [EC:3.5.2.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00340  Histidine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    144193 (AMDHD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.7  imidazolonepropionase
     144193 (AMDHD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_3 Amidohydro_1
Motif
Other DBs
NCBI-GeneID: 144193
NCBI-ProteinID: NP_689648
HGNC: 28577
Ensembl: ENSG00000139344
Vega: OTTHUMG00000170353
Pharos: Q96NU7(Tdark)
UniProt: Q96NU7 B3KVC5
Position
12q23.1
AA seq 426 aa AA seqDB search
MASGHSLLLENAQQVVLVCARGERFLARDALRSLAVLEGASLVVGKDGFIKAIGPADVIQ
RQFSGETFEEIIDCSGKCILPGLVDAHTHPVWAGERVHEFAMKLAGATYMEIHQAGGGIH
FTVERTRQATEEELFRSLQQRLQCMMRAGTTLVECKSGYGLDLETELKMLRVIERARREL
DIGISATYCGAHSVPKGKTATEAADDIINNHLPKLKELGRNGEIHVDNIDVFCEKGVFDL
DSTRRILQRGKDIGLQINFHGDELHPMKAAELGAELGAQAISHLEEVSDEGIVAMATARC
SAILLPTTAYMLRLKQPRARKMLDEGVIVALGSDFNPNAYCFSMPMVMHLACVNMRMSMP
EALAAATINAAYALGKSHTHGSLEVGKQGDLIIINSSRWEHLIYQFGGHHELIEYVIAKG
KLIYKT
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcggccacagcctcctgctggagaacgcgcagcaagtggtgctggtgtgcgcc
cgcggcgagcgcttcctggcgcgggatgcgctgcgcagcctggcggtgctggaaggcgcc
agcctggtggtgggcaaagatggatttataaaagctattggtcctgctgatgttattcaa
agacagttttctggagaaacttttgaagaaataattgactgctctgggaaatgtattcta
ccaggtttggtggatgcacacacacatccagtatgggctggtgaaagagttcacgaattt
gcaatgaagttggcaggagccacctacatggaaattcaccaggccggaggagggatccac
tttaccgtggagcgcacgcgccaagccacagaggaggagctgttccgctccttgcagcaa
cggctccagtgcatgatgagggctggcaccacgctggtggagtgcaagagtggatatggc
ctcgacctggagaccgagctcaagatgctgcgcgtgattgagcgcgcccggcgggagctg
gacatcggcatctcggctacctactgcggggctcattcagtgcctaaaggaaaaactgct
actgaagctgctgatgacatcatcaataaccacctcccaaagctgaaggaacttggcaga
aatggggaaatacacgtggacaatatagacgtattttgtgagaaaggtgtctttgatctc
gattccaccagaaggattcttcaacgtggaaaagatatagggttacagattaacttccat
ggggatgaactccacccgatgaaggctgctgagcttggggctgaactgggagcgcaggca
atcagccacctggaagaagtgagtgatgaaggcatcgttgccatggcaacggccaggtgc
tctgccatccttctgcccaccacagcctacatgctgagactgaaacaacctcgagccagg
aagatgttagatgaaggagtaatagttgctctgggaagtgatttcaaccccaatgcatat
tgcttttcaatgccaatggtcatgcatctggcctgtgtaaacatgagaatgtccatgcct
gaggccttggccgctgccaccatcaatgcagcttatgcactgggaaagtctcacacacac
ggatcgttggaagttggcaaacagggagatctcattatcatcaattcatcccgatgggag
catttgatttaccagttcggaggccatcatgaattaattgaatatgttatagctaaagga
aaactcatctataaaacatga

DBGET integrated database retrieval system