KEGG   Homo sapiens (human): 1442Help
Entry
1442              CDS       T01001                                 

Gene name
CSH1, CS-1, CSA, CSMT, PL, hCS-1, hCS-A
Definition
chorionic somatomammotropin hormone 1 (placental lactogen)
Orthology
K05438  
growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q24.2
AA seq 217 aa AA seqDB search
MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctccaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttcccttatccaggctttttgaccacgctatg
ctccaagcccatcgcgcgcaccagctggccattgacacctaccaggagtttgaagaaacc
tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctccttctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcaacagaaatccaatctagag
ctgctccgcatctccctgctgctcatcgagtcgtggctggagcccgtgcggttcctcagg
agtatgttcgccaacaacctggtgtatgacacctcggacagcgatgactatcacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagacggcagccgccgg
actgggcagatcctcaagcagacctacagcaagtttgacacaaactcgcacaaccatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtggagggcagctgtggcttctag

DBGET integrated database retrieval system