KEGG   Homo sapiens (human): 145173Help
Entry
145173            CDS       T01001                                 

Gene name
B3GLCT, B3GALTL, B3GTL, B3Glc-T, Gal-T, beta3Glc-T
Definition
(RefSeq) beta 3-glucosyltransferase
  KO
K13675  UDP-glucose:O-linked fucose beta-1,3-glucosyltransferase [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00514  Other types of O-glycan biosynthesis
Disease
H01075  Peters anomaly
H01159  Anterior segment dysgenesis (ASD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    145173 (B3GLCT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     145173 (B3GLCT)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   145173 (B3GLCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T DUF604 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 145173
NCBI-ProteinID: NP_919299
OMIM: 610308
HGNC: 20207
Ensembl: ENSG00000187676
Vega: OTTHUMG00000016688
Pharos: Q6Y288(Tbio)
UniProt: Q6Y288
Position
13q12.3
AA seq 498 aa AA seqDB search
MRPPACWWLLAPPALLALLTCSLAFGLASEDTKKEVKQSQDLEKSGISRKNDIDLKGIVF
VIQSQSNSFHAKRAEQLKKSILKQAADLTQELPSVLLLHQLAKQEGAWTILPLLPHFSVT
YSRNSSWIFFCEEETRIQIPKLLETLRRYDPSKEWFLGKALHDEEATIIHHYAFSENPTV
FKYPDFAAGWALSIPLVNKLTKRLKSESLKSDFTIDLKHEIALYIWDKGGGPPLTPVPEF
CTNDVDFYCATTFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRIPIVKQTWESQASLIEY
YSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIVDDDTLISISRLQ
HLLSCYDSGEPVFLGERYGYGLGTGGYSYITGGGGMVFSREAVRRLLASKCRCYSNDAPD
DMVLGMCFSGLGIPVTHSPLFHQARPVDYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAP
SDEDKARQETQKGFREEL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgcccgcctgctggtggctgctcgcgccgccggcgctgctcgcgctcctcacc
tgctccctggcttttggtttggcttctgaagatacaaagaaagaggtcaagcagtctcag
gatttggagaaaagtggtatatcaaggaaaaatgacatagacttaaaaggaattgtattc
gtcatccagagtcaaagtaattcttttcatgcaaagagagcagagcagttaaaaaaaagc
atcttaaagcaggctgcagatcttacacaggagctccccagtgtcctcctccttcatcag
ctggctaaacaagaaggtgcatggaccatacttccgttgttaccgcatttttctgtaaca
tatagcagaaattcatcttggattttcttctgtgaagaagagacaagaatacagattcca
aaactcttggaaaccctcagaagatatgacccctctaaggaatggtttttgggaaaagca
ttacatgatgaagaagctacaataattcaccattatgccttttccgagaatcctacagtt
tttaagtatccagactttgctgcaggctgggccttaagtattccacttgtaaacaagctt
accaagagactaaagagtgaatccttgaaatccgactttacaatagatttaaaacatgag
attgccctctacatctgggacaaaggcggaggacctcccctgaccccagtgcctgagttt
tgtaccaatgacgtggacttctactgtgctaccacattccattcttttctaccgctttgt
agaaagccagtgaagaagaaggatatttttgttgcagtaaaaacatgcaagaaatttcat
ggtgacagaatacctattgttaagcagacttgggagagccaggcaagtctcattgaatac
tatagtgactatactgaaaattccattcctactgtggatttgggaattcctaatacagat
agaggtcattgtggaaagacatttgccattttggaaagatttctgaatcgtagccaggac
aaaacagcatggttagtcattgtggatgatgatacattaataagtatctccaggctccag
cacttgcttagctgttatgactccggcgagcctgtgtttctgggagagcgctacggctac
ggcctgggcactggtggctacagctacatcacgggaggaggaggaatggtcttcagcaga
gaagccgtcaggagacttctcgccagtaaatgtcgatgctacagcaatgatgctcccgat
gatatggtcctgggaatgtgctttagtggcttgggaatccctgtgacacacagccctctc
ttccatcaggctcggccggtggattaccctaaggactacctttctcatcaagttcccata
tcgttccacaaacactggaacatcgatccagtgaaggtgtatttcacatggttggcaccc
agtgacgaagacaaagccaggcaggagacacagaaaggttttcgagaggagttataa

DBGET integrated database retrieval system