KEGG   Homo sapiens (human): 145957Help
Entry
145957            CDS       T01001                                 

Gene name
NRG4, HRG4
Definition
(RefSeq) neuregulin 4
  KO
K05458  neuregulin 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    145957 (NRG4)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   145957 (NRG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF EGF_2 Laminin_EGF
Motif
Other DBs
NCBI-GeneID: 145957
NCBI-ProteinID: NP_612640
OMIM: 610894
HGNC: 29862
Ensembl: ENSG00000169752
Vega: OTTHUMG00000142917
Pharos: Q8WWG1(Tbio)
UniProt: Q8WWG1
Position
15q24.2
AA seq 115 aa AA seqDB search
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN
LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgccaacagatcacgaagagccctgtggtcccagtcacaagtcgttttgcctgaatggg
gggctttgttatgtgatacctactattcccagcccattttgtaggtgcgttgaaaactat
acaggagctcgttgtgaagaggtttttctcccaggctccagcatccaaactaaaagtaac
ctgtttgaagcttttgtggcattggcggtcctagtaacacttatcattggagccttctac
ttcctttgcaggaaaggccactttcagagagccagttcagtccagtatgatatcaacctg
gtagagacgagcagtaccagtgcccaccacagtcatgaacaacactga

DBGET integrated database retrieval system