KEGG   Homo sapiens (human): 145957Help
Entry
145957            CDS       T01001                                 

Gene name
NRG4, HRG4
Definition
neuregulin 4
Orthology
K05458  
neuregulin 4
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
15q24.2
AA seq 115 aa AA seqDB search
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN
LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgccaacagatcacgaagagccctgtggtcccagtcacaagtcgttttgcctgaatggg
gggctttgttatgtgatacctactattcccagcccattttgtaggtgcgttgaaaactat
acaggagctcgttgtgaagaggtttttctcccaggctccagcatccaaactaaaagtaac
ctgtttgaagcttttgtggcattggcggtcctagtaacacttatcattggagccttctac
ttcctttgcaggaaaggccactttcagagagccagttcagtccagtatgatatcaacctg
gtagagacgagcagtaccagtgcccaccacagtcatgaacaacactga

DBGET integrated database retrieval system