KEGG   Homo sapiens (human): 146057Help
Entry
146057            CDS       T01001                                 

Gene name
TTBK2, SCA11, TTBK
Definition
tau tubulin kinase 2 (EC:2.7.11.1)
Orthology
K08815  
tau tubulin kinase [EC:2.7.11.26]
Organism
hsa  Homo sapiens (human)
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     146057 (TTBK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CK1 group
  TTBK family
   146057 (TTBK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q15.2
AA seq 1244 aa AA seqDB search
MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQV
LKMEVAVLKKLQGKDHVCRFIGCGRNDRFNYVVMQLQGRNLADLRRSQSRGTFTISTTLR
LGRQILESIESIHSVGFLHRDIKPSNFAMGRFPSTCRKCYMLDFGLARQFTNSCGDVRPP
RAVAGFRGTVRYASINAHRNREMGRHDDLWSLFYMLVEFVVGQLPWRKIKDKEQVGSIKE
RYDHRLMLKHLPPEFSIFLDHISSLDYFTKPDYQLLTSVFDNSIKTFGVIESDPFDWEKT
GNDGSLTTTTTSTTPQLHTRLTPAAIGIANATPIPGDLLRENTDEVFPDEQLSDGENGIP
VGVSPDKLPGSLGHPRPQEKDVWEEMDANKNKIKLGICKAATEEENSHGQANGLLNAPSL
GSPIRVRSEITQPDRDIPLVRKLRSIHSFELEKRLTLEPKPDTDKFLETCLEKMQKDTSA
GKESILPALLHKPCVPAVSRTDHIWHYDEEYLPDASKPASANTPEQADGGGSNGFIAVNL
SSCKQEIDSKEWVIVDKEQDLQDFRTNEAVGHKTTGSPSDEEPEVLQVLEASPQDEKLQL
GPWAENDHLKKETSGVVLALSAEGPPTAASEQYTDRLELQPGAASQFIAATPTSLMEAQA
EGPLTAITIPRPSVASTQSTSGSFHCGQQPEKKDLQPMEPTVELYSPRENFSGLVVTEGE
PPSGGSRTDLGLQIDHIGHDMLPNIRESNKSQDLGPKELPDHNRLVVREFENLPGETEEK
SILLESDNEDEKLSRGQHCIEISSLPGDLVIVEKDHSATTEPLDVTKTQTFSVVPNQDKN
NEIMKLLTVGTSEISSRDIDPHVEGQIGQVAEMQKNKISKDDDIMSEDLPGHQGDLSTFL
HQEGKREKITPRNGELFHCVSENEHGAPTRKDMVRSSFVTRHSRIPVLAQEIDSTLESSS
PVSAKEKLLQKKAYQPDLVKLLVEKRQFKSFLGDLSSASDKLLEEKLATVPAPFCEEEVL
TPFSRLTVDSHLSRSAEDSFLSPIISQSRKSKIPRPVSWVNTDQVNSSTSSQFFPRPPPG
KPPTRPGVEARLRRYKVLGSSNSDSDLFSRLAQILQNGSQKPRSTTQCKSPGSPHNPKTP
PKSPVVPRRSPSASPRSSSLPRTSSSSPSRAGRPHHDQRSSSPHLGRSKSPPSHSGSSSS
RRSCQQEHCKPSKNGLKGSGSLHHHSASTKTPQGKSKPASKLSR
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggggaggagagcagctggatatcctgagtgttggaatcctagtgaaagaaaga
tggaaagtgttgagaaagattgggggtgggggctttggagaaatttacgatgccttggac
atgctcaccagggaaaatgttgcactgaaggtggaatcagctcaacaaccaaaacaagtt
ctgaaaatggaagttgctgttttgaaaaagctgcaagggaaagaccatgtttgtagattt
attggctgtgggaggaatgatcgattcaactatgtggtcatgcagttgcagggtcggaat
ctggcagatcttcgccgtagccagtcccgaggcacattcaccattagtaccactctccgg
ctgggtagacagattttggagtctattgaaagcattcattctgtgggattcttgcatcga
gacatcaaaccgtcgaacttcgctatgggtcgctttcctagtacatgtaggaaatgttac
atgcttgattttggcttggctcgacaatttaccaattcctgtggtgacgtcagaccacct
cgagctgtggcaggttttcgagggacagttcgttatgcatcaatcaacgcacatcggaac
agggaaatgggaagacatgatgacctttggtccttattctacatgttggtggagtttgtg
gttggtcagctgccctggagaaaaataaaggacaaggagcaagtaggctctattaaggag
agatatgaccacaggctcatgttgaaacatctccctccagaattcagcatctttctagac
catatctcttctttggattattttacaaaaccagactaccagcttcttacatccgtgttt
gacaatagcatcaagacttttggagtaattgagagtgacccttttgactgggagaagact
ggaaatgatggctccctaacaaccaccactacttctaccacccctcagttgcacactcgc
ttgacccctgctgcaattggaattgccaatgctactcccatccctggagacttgcttcga
gaaaatacagatgaggtatttccagatgaacagcttagcgatggagaaaatggcatccct
gttggtgtgtcaccagataaattgcctggatctctgggacacccccgtccccaggagaag
gatgtttgggaagagatggatgccaacaaaaacaagataaagcttggaatttgtaaggct
gctactgaagaggagaacagccatggccaggcaaatggtcttctcaatgctccaagcctt
gggtcaccaattcgtgtccgctcagagattactcagccagacagagatattccactggtg
cgaaagttacgttccattcacagctttgagctggaaaaacgtctgaccctggagccaaag
ccagacactgacaagttccttgagacctgcctggagaaaatgcagaaagataccagtgca
ggaaaagaatctattctccctgctctgctgcataagccttgcgttcctgctgtgtcccgt
actgaccacatctggcactatgatgaagaatatcttccagatgcctccaagcctgcttct
gccaacacccctgagcaggcagatggtggtggcagcaatggatttatagctgttaacctg
agctcttgcaagcaagaaattgattccaaagaatgggtgattgtggacaaggagcaggac
cttcaggattttaggacaaatgaggctgtaggacataaaacaactggaagtccttctgat
gaggagcctgaagtacttcaagtcctggaggcatcacctcaagatgaaaagctccagtta
ggtccttgggcagaaaatgatcatttaaagaaggaaacctcaggtgtggtcttagcactt
tctgcagagggtcctcctactgctgcttcagaacaatatacagataggctggaactccag
cctggagctgctagtcagtttattgcagcgacgcccacaagtctaatggaggcgcaggca
gaaggaccccttacagcgattacaattcctagaccttctgtggcatctacacagtcaact
tcaggaagctttcactgtggtcagcagccagagaagaaagatcttcagcccatggagccc
actgtggaactttactctccaagggaaaacttctctggcttggttgtgacagagggtgaa
cctcctagtggaggaagcagaacagatttggggcttcagatagatcacattggtcatgac
atgttacccaacattagagaaagtaacaaatctcaagacctgggaccaaaagaacttcct
gatcataatagactggttgtgagagaatttgaaaatctccctggggaaactgaagagaaa
agcatccttttagagtcagataatgaagatgagaagttaagtagagggcagcattgtatt
gagatctcctctctcccaggagatttggtaattgtggaaaaggatcactcagctactact
gaacctcttgatgtgacaaaaacacagacttttagtgtggtgccaaatcaagacaaaaat
aatgagataatgaagcttctgacagttggaacttcagaaatttcttccagagacattgac
ccacatgttgaaggtcagataggccaagtggcagaaatgcaaaaaaataagatatctaag
gatgatgacatcatgagtgaagacttgccaggtcatcaaggagacctctctacttttttg
caccaagagggcaagagagagaaaatcacccctagaaatggagaactatttcattgtgtt
tcagagaatgaacatggtgccccaacccggaaggatatggttaggtcatcctttgtaact
agacacagccgaatccctgttttagcacaagagatagactcaactttggaatcatcctct
ccagtttctgcaaaagaaaagctcctccaaaagaaagcctatcagccagacctagtcaag
cttctggtggaaaaaagacaattcaagtccttccttggcgacctctcaagtgcctctgat
aaattgctagaggagaaactagctactgttcctgctcccttttgtgaggaggaagtgctc
actcccttttcaagactgacagtagattctcacctgagtaggtcagctgaagatagcttt
ctgtcacccatcatctcccagtctagaaagagcaaaattccaaggccagtttcatgggtc
aacacagatcaggtcaatagctcaacttcgtctcagttctttcctcggccaccaccagga
aagccacccacgaggcctggagtagaagccaggctacgcagatataaagtcctagggagt
agtaactccgactcagaccttttctcccgcctggcccaaattcttcaaaatggatctcag
aaaccccggagcactactcagtgcaagagtccaggatctcctcacaatccaaaaacacca
cccaagagtccagttgtccctcgcaggagtcccagtgcctctcctcgaagctcatccttg
cctcgcacgtctagttcctcaccatctagggctggacggccccaccatgaccagaggagt
tcgtccccacatctggggagaagcaagtcacctcccagccactcaggatcttcctcctcc
aggaggtcctgccaacaggagcattgcaaacccagcaagaatggcctgaaaggatccggc
agcctccaccaccactcagccagcactaaaaccccccaagggaagagtaagccagccagt
aaactcagcagatag

DBGET integrated database retrieval system