KEGG   Homo sapiens (human): 146059Help
Entry
146059            CDS       T01001                                 

Gene name
CDAN1, CDA1, CDAI, CDAN1A, DLT, PRO1295
Definition
codanin 1
Organism
hsa  Homo sapiens (human)
Disease
H00917  
Congenital dyserythropoietic anemias (CDAs)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q15.2
AA seq 1227 aa AA seqDB search
MAAVLESLLREEVSVAAVVRWIARSTQGSEDNAGEAAALSSLRALRKEFVPFLLNFLREQ
SSRVLPQGPPTPAKTPGASAALPGRPGGPPRGSRGARSQLFPPTEAQSTAAEAPLARRGG
RRRGPGPARERGGRGLEEGVSGESLPGAGGRRLRGSGSPSRPSLTLSDPPNLSNLEEFPP
VGSVPPGPTGTKPSRRINPTPVSEERSLSKPKTCFTSPPISCVPSSQPSALDTSPWGLGL
PPGCRSLQEEREMLRKERSKQLQQSPTPTCPTPELGSPLPSRTGSLTDEPADPARVSSRQ
RLELVALVYSSCIAENLVPNLFLELFFVFQLLTARRMVTAKDSDPELSPAVLDSLESPLF
QSIHDCVFFAVQVLECHFQVLSNLDKGTLKLLAENERLLCFSPALQGRLRAAYEGSVAKV
SLVMPPSTQAVSFQPETDNRANFSSDRAFHTFKKQRDVFYEVLREWEDHHEEPGWDFEKG
LGSRIRAMMGQLSAACSHSHFVRLFQKQLLQMCQSPGGAGGTVLGEAPDVLSMLGADKLG
RLWRLQERLMAPQSSGGPCPPPTFPGCQGFFRDFILSASSFQFNQHLMDSLSLKIQELNG
LALPQHEPNDEDGESDVDWQGERKQFAVVLLSLRLLAKFLGFVAFLPYRGPEPPPTGELQ
DSILALRSQVPPVLDVRTLLQRGLQARRAVLTVPWLVEFLSFADHVVPLLEYYRDIFTLL
LRLHRSLVLSQESEGKMCFLNKLLLLAVLGWLFQIPTVPEDLFFLEEGPSYAFEVDTVAP
EHGLDNAPVVDQQLLYTCCPYIGELRKLLASWVSGSSGRSGGFMRKITPTTTTSLGAQPS
QTSQGLQAQLAQAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVRQAESLLQEQ
LVTQGEEGGDPAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSS
AENIAVGLATEKACAWLSANITALIRREVKAAVSRTLRAQGPEPAARGERRGCSRACEHH
APLPSHLISEIKDVLSLAVGPRDPDEGVSPEHLEQLLGQLGQTLRCRQFLCPPAEQHLAK
CSVELASLLVADQIPILGPPAQYRLERGQARRLLHMLLSLWKEDFQGPVPLQLLLSPRNV
GLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFL
AEPHLPEPQLRACELVQPNRGTVLAQS
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgttttggagtcgctgctgcgagaagaggtgtcggtcgcagccgtcgtgcgg
tggatcgcgcgcagcacccagggttcggaggataacgctggggaggcggccgcgctgagc
tcactccgggccctgcggaaagaattcgtaccgttcctgttgaacttcctgagggagcag
agcagccgcgtcctcccgcaggggcccccgacccccgccaagaccccgggcgcctcggca
gccttgccagggaggccgggaggcccgccgcggggtagccgcggggcgcgcagccagctt
ttccctccgaccgaggcccagagcaccgctgccgaggcccctctggcccgccgcgggggc
aggaggcggggcccggggccggcccgcgagcgtggaggccgcggcctggaggagggggtc
agcggggagagcctgcccggagccgggggccggaggcttaggggctctggcagccccagc
cgccccagcctcacgctgtctgatccgccaaacctcagcaacctggaggagttccctccc
gtaggctcggttccccccggccctacagggacgaagccttctcgcaggatcaacccaact
ccggtgagcgaagagcggtcactctccaagcccaagacctgcttcacctcacccccaatc
agctgtgtccccagttcccaaccctcagccctggacactagcccttggggccttggcctt
cccccagggtgcagaagtctgcaagaggagcgagagatgctcaggaaggagcgctctaag
cagctgcagcagtcacctacccccacctgtcccaccccagaattggggtcgcccctcccc
agccggacaggaagcctcacagatgaacctgcagaccctgccagagtgtcttcccgccag
cgcctggagcttgtagcccttgtttactcctcgtgcattgctgagaacctggtaccaaac
ctcttcttggagcttttcttcgtctttcagctcctcactgcccggaggatggtgactgcc
aaggacagcgaccctgaactaagtccagctgtcctagattccctggaaagtccactgttc
caaagcatccacgattgtgtcttctttgcagtgcaggttttggagtgtcactttcaggtt
ctttccaacctggacaaagggaccttgaagctgctggctgagaatgagcggctgctgtgc
ttctcaccagctctgcaaggccgccttcgagctgcctatgagggcagtgttgccaaggtc
tctctggtgatgcctccctctactcaagctgtctcctttcagccagagactgacaatcgt
gccaacttctccagtgaccgagcctttcatacttttaagaaacagagggatgtgttttat
gaggtgctgcgagagtgggaagatcaccatgaggagcctggctgggattttgagaagggc
ttgggcagcagaatcagggccatgatgggtcagctctccgcagcctgcagccacagccac
tttgttcggcttttccaaaaacaactactccagatgtgtcagagccctggtggtgctggg
ggcaccgtcttgggcgaggccccagatgtgttgagtatgctgggagctgacaagctgggg
cggttgtggcgcctacaggaacggcttatggctcctcagagcagtggggggccctgccca
ccccccaccttcccaggctgtcaaggcttctttagggacttcatccttagtgccagcagc
ttccagtttaaccagcatctcatggacagtctgagcttgaagatccaggagctcaatggt
cttgccctgccccagcatgagcccaatgatgaagacggggagtcagacgtagactggcag
ggtgagcggaagcaatttgctgtggtgcttcttagcctgagacttttggctaaattcctg
ggctttgtggctttcctgccataccgggggcctgaacctcccccgaccggtgagcttcag
gactccattctggccctcaggagccaggtccctccggtcctggatgtgcggactctgctg
cagcgagggctgcaggcccgccgggcggtgctcaccgtgccctggctggtggagtttctc
tcctttgctgaccatgttgttcccttgctggaatattaccgggacatcttcactctcctg
ctgcgcctgcaccggagcttggtgttgtcgcaggagagtgaggggaagatgtgtttcctg
aacaagctgctgctacttgctgtcctgggctggcttttccagattcccacagtccctgag
gacttgttctttctggaagagggtccctcatatgcctttgaggtggacacagtagcccca
gagcatggcttggacaatgcgcctgtggtggaccagcagctgctctacacctgctgcccc
tacatcggagagctccggaaactgctcgcttcgtgggtgtcaggcagtagtggacggagt
gggggcttcatgaggaaaatcacccccaccactaccaccagcctgggagcccagccttcc
cagaccagccaggggctgcaggcacagctcgcccaggcctttttccacaaccagccgccc
tccttgcgccggaccgtagagttcgtggcagaaagaattggatcaaactgtgtcaaacat
atcaaggctacactggtggcagatctggtgcgccaggcagagtcacttctccaagagcag
ctggtgacacagggagaggaagggggagacccagcccagctgttggagatcttgtgttcc
cagctgtgccctcacggggcccaggcattggccctggggcgggagttctgtcaaaggaag
agccctggggctgtgcgggcgctgcttccagaggagaccccggcagccgttctgagcagt
gcagagaacattgctgtggggcttgcaacagagaaagcctgtgcttggctgtcagccaac
atcacagcactgatcaggagggaggtgaaagcagcagtgagtcgcacacttcgagcccag
ggtcctgaacctgctgcccggggggagcggaggggctgctcccgcgcctgtgagcaccat
gctcccctcccctcccacctcatctccgagataaaagacgtgctctccttggccgtgggg
ccacgggaccctgacgagggagtctccccagagcatctggaacagctcctaggccagctg
ggccagacgctgcggtgccgccagttcctgtgcccacctgctgagcagcatctggcaaag
tgctctgtggagttagcttccctcctcgttgcagatcaaattcctatcctagggcccccg
gcacagtacaggctggagagagggcaggctcgaaggcttctgcacatgctgctttccttg
tggaaggaagactttcaggggccggttccgctgcagctgctgctgagcccaagaaatgtg
gggcttctggcagacacaaggccaagggagtgggacttgctgctattcttgctacgggag
ctggtggagaagggtctgatgggacggatggagatagaggcctgcctgggcagcctccac
caggcccagtggccaggggactttgctgaagaattagcaacactgtctaatctgtttcta
gccgagccccacctgccagaaccccagctaagagcctgtgagttggtgcagccaaaccgg
ggcactgtgctggcccagagctag

DBGET integrated database retrieval system