KEGG   Homo sapiens (human): 146754Help
Entry
146754            CDS       T01001                                 

Gene name
DNAH2, DNAHC2, DNHD3
Definition
(RefSeq) dynein, axonemal, heavy chain 2
  KO
K10408  
dynein heavy chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    146754 (DNAH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 872 aa AA seqDB search
MSSKAEKKQRLSGRGSSQASWSGRATRAAVATQEQGNAPAVSEPELQAELPKEEPEPRLE
GPQAQSEESVEPEADVKPLFLSRAALTGLADAVWTQEHDAILEHFAQDPTESILTIFIDP
CFGLKLELGMPVQTQNQLVYFIRQAPVPITWENFEATVQFGTVRGPYIPALLRLLGGVFA
PQIFANTGWPESIRNHFASHLHKFLACLTDTRYKLEGHTVLYIPAEAMNMKPEMVIKDKE
LVQRLETSMIHWTRQIKEMLSAQETVETGENLGPLEEIEFWRNRCMDLSGISKQLVKKGV
KHVESILHLAKSSYLAPFMKLAQQIQDGSRQAQSNLTFLSILKEPYQELAFMKPKDISSK
LPKLISLIRIIWVNSPHYNTRERLTSLFRKMSNEIIRLCCHAISLDRIFEGYVSSSKEDL
QGCILCCHAWKDHYVQAVQMHIQFSSRGWVLDQTSIFAQVDAFVQRCKDLIEVCDCQYHF
ARWEDGKQGPLPCFFGAQGPQITRNLLEIEDIFHKNLHTLRAVRGGILDVKNTCWHEDYN
KFRAGIKDLEVMTQNLITSAFELVRDVPHGVLLLDTFHRLASREAIKRTYDKKAVDLYML
FNSELALVNRERNKKWPDLEPYVAQYSGKARWVHILRRRIDRVMTCLAGAHFLPRIGTGK
ESVHTYQQMVQAIDELVRKTFQEWTSSLDKDCIRRLDTPLLRISQEKAGMLDVNFDKYRS
HLAPFPYTPLLQLSQEFHSHLLTPLFIILSLSHTICLLSSFYFFFSSFIFVSPHLPPCYQ
HFNFTTYLKTQQNKTMIGQARWLTPVIPALWEAEVGASLEPRSLRTAWATWQNPVSAKNT
KISWAWWHKPVVSATWEGEVGGSPEPGRQRLQ
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaagctgagaagaagcagcgattgagtggccgaggaagctcccaggcaagc
tggtcagggcgggccactcgggctgctgtggccacacaggagcaggggaatgccccggct
gtcagtgagccagagctgcaggctgagctccccaaggaggagcctgagccacggttggag
ggacctcaagcacagagtgaagaatcagtggagcccgaggcagatgtgaagcccctcttc
ctttcccgagctgcgctgacaggactggcggatgcagtgtggacacaggagcatgatgcc
attctggaacactttgcccaggaccctacagaatccatcctcaccatcttcattgaccct
tgttttgggctgaagctagagctgggcatgcctgtacagacccagaaccagcttgtctac
ttcattcgccaagcaccagttcccatcacctgggagaacttcgaggcaactgtgcagttt
gggacggtgcggggcccctatatcccggccctgcttcggctgctcggtggagtctttgcc
cctcagatctttgcaaacacaggctggcctgagagcattagaaatcattttgcttctcat
ctgcacaagttcttggcctgcctgacagacactcggtacaaactggaggggcacacggtc
ctctacatccctgcagaggccatgaacatgaagcctgagatggtgataaaggacaaagag
ctggtgcaacggctagagacctccatgatccactggacccggcagataaaggagatgctc
agtgcccaggagactgtggagacaggagaaaatttaggtcctctggaggagattgagttc
tggcgcaaccgatgcatggacctgtctggcatcagtaagcagctggtgaagaagggagtg
aagcacgttgaatccatcctgcaccttgccaagtcgtcctacttggcgccctttatgaaa
ctggcacagcagatccaggatggctctcgtcaagcacagtcaaacctgacctttttgtca
atcctgaaggaaccttaccaggagttggctttcatgaagcccaaggacatctctagcaag
ctccctaagctgatcagtctcatccgcatcatctgggtcaactctccccactacaacact
cgggagagactgacctcgctcttccgaaagatgagcaatgagatcatccgcttatgctgc
cacgccatctccctggaccggatctttgagggatatgtctcttccagcaaggaggacctg
caaggctgcattctctgttgtcacgcttggaaagatcactacgtacaggctgtgcagatg
cacatccagttctccagtcggggctgggtcctagatcagaccagcatctttgctcaggtt
gatgcctttgtgcagcgctgcaaggaccttattgaggtatgtgactgtcagtatcacttc
gcccgctgggaagatggcaagcagggtccccttccttgcttctttggtgcccaggggcca
cagataacacggaacttgctggagattgaggacatctttcataaaaatctgcacacgctg
cgagccgttcgcgggggtatcctggatgtcaagaacacctgttggcatgaagactacaat
aagttccgtgccggaatcaaggacctggaggtgatgacccagaacctgatcacctcagcc
ttcgagttggtgcgggacgtgccgcacggcgtgcttctgctggacaccttccacaggctt
gcctcccgcgaggctatcaagcggacttatgacaagaaggcggtggatctctacatgctg
ttcaatagcgagctggccctggtgaaccgtgaacggaacaagaaatggccagacctggag
ccctacgtggcccagtattccggaaaggcgcgctgggtgcacatcctccggcgtcgcatc
gacagagtcatgacctgccttgctggtgctcatttcctgccccgtattgggactggaaag
gagagtgtgcacacctatcagcagatggtccaggccattgatgagctggttcgaaaaacc
ttccaagagtggacatcaagtctggacaaggattgcattcggcggttggataccccattg
ctgcgaatcagccaggagaaggcgggcatgctggatgtcaactttgacaagtacaggagc
cacctggccccttttccctatactccccttctgcagctctcccaagaatttcactcccat
cttttgactcctctcttcattattctctctctttctcatacaatatgtttgctatcgtca
ttttacttttttttttcttcttttatttttgtctctccccacctcccaccctgctatcaa
cattttaattttacaacttatcttaaaacacaacaaaacaaaacaatgatcggccaggca
cggtggctcacacctgtaatcccagcactttgggaggctgaggtgggcgcatcgcttgag
cccaggagtttgagaacagcctgggcaacatggcaaaacccagtctctgcaaaaaataca
aagattagctgggcgtggtggcacaagcctgtagtctcagctacttgggagggtgaggtg
ggaggatcgcctgagcccgggaggcagaggctgcagtga

DBGET integrated database retrieval system