KEGG   Homo sapiens (human): 1468Help
Entry
1468              CDS       T01001                                 

Gene name
SLC25A10, DIC
Definition
(RefSeq) solute carrier family 25 member 10
  KO
K13577  
solute carrier family 25 (mitochondrial dicarboxylate transporter), member 10
Organism
hsa  Homo sapiens (human)
Pathway
Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    1468 (SLC25A10)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   1468 (SLC25A10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 287 aa AA seqDB search
MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILAL
YSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPA
DLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLS
CYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHC
AVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgaggcgcgcgtgtcgcgctggtacttcggggggctggcctcctgcggggcc
gcctgctgcacgcacccgctggacctgctcaaggtgcatctgcagacgcagcaggaggtg
aagctgcgcatgacgggcatggcgctgcgggtggtgcgtaccgacggcatcctggcactc
tacagcggcctgagcgcctcgctgtgcagacagatgacctactccctgactcggttcgcc
atctacgagactgtgcgggaccgtgtggccaagggcagccaggggcctctccccttccac
gagaaggtgttgctgggctccgtcagcggtttagctggaggcttcgtggggacgcccgca
gacttggtcaacgtcaggatgcagaacgacgtgaagctgccccagggtcagcggcgcaac
tacgcccatgcgctggatggcctgtaccgcgtagctcgtgaagagggtctcaggagactg
ttctcgggtgcaaccatggcatccagccgaggggccttagtcactgtgggccagctgtcc
tgctacgaccaggccaagcagctggtccttagcaccgggtacctctctgacaacatcttc
actcactttgtcgccagctttattgcaggtggatgtgccacgttcctgtgccagcccctg
gatgtgctgaagactcgcctgatgaactccaagggggagtatcagggcgttttccactgc
gccgtggagacagcgaagctcgggcctctggccttttacaagggcctcgtcccagctggc
atccgcctcatcccccacaccgtgctcacttttgtgtttctggaacagctacgcaaaaac
tttggcatcaaagtgccatcctga

DBGET integrated database retrieval system