KEGG   Homo sapiens (human): 1468Help
Entry
1468              CDS       T01001                                 

Gene name
SLC25A10, DIC
Definition
solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10
Orthology
K13577  
solute carrier family 25 (mitochondrial dicarboxylate transporter), member 10
Organism
hsa  Homo sapiens (human)
Pathway
Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    1468 (SLC25A10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 296 aa AA seqDB search
MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILAL
YSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPA
DLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLS
CYDQAKQLVLSTGYLSDNIFTHFVASFIAAAGDEPPPQGGCATFLCQPLDVLKTRLMNSK
GEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgaggcgcgcgtgtcgcgctggtacttcggggggctggcctcctgcggggcc
gcctgctgcacgcacccgctggacctgctcaaggtgcatctgcagacgcagcaggaggtg
aagctgcgcatgacgggcatggcgctgcgggtggtgcgtaccgacggcatcctggcactc
tacagcggcctgagcgcctcgctgtgcagacagatgacctactccctgactcggttcgcc
atctacgagactgtgcgggaccgtgtggccaagggcagccaggggcctctccccttccac
gagaaggtgttgctgggctccgtcagcggtttagctggaggcttcgtggggacgcccgca
gacttggtcaacgtcaggatgcagaacgacgtgaagctgccccagggtcagcggcgcaac
tacgcccatgcgctggatggcctgtaccgcgtagctcgtgaagagggtctcaggagactg
ttctcgggtgcaaccatggcatccagccgaggggccttagtcactgtgggccagctgtcc
tgctacgaccaggccaagcagctggtccttagcaccgggtacctctctgacaacatcttc
actcactttgtcgccagctttattgcagccgctggtgacgagccccctcctcagggtgga
tgtgccacgttcctgtgccagcccctggatgtgctgaagactcgcctgatgaactccaag
ggggagtatcagggcgttttccactgcgccgtggagacagcgaagctcgggcctctggcc
ttttacaagggcctcgtcccagctggcatccgcctcatcccccacaccgtgctcactttt
gtgtttctggaacagctacgcaaaaactttggcatcaaagtgccatcctga

DBGET integrated database retrieval system