KEGG   Homo sapiens (human): 146802Help
Entry
146802            CDS       T01001                                 

Gene name
SLC47A2, MATE2, MATE2-B, MATE2-K, MATE2K
Definition
(RefSeq) solute carrier family 47 member 2
  KO
K03327  
multidrug resistance protein, MATE family
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   146802 (SLC47A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p11.2
AA seq 602 aa AA seqDB search
MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCG
HLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLL
LCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWL
KGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVVGNCVNGVANYALVSV
LNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSML
MICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAAD
TVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVF
EAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFL
ATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITL
TTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILAT
RH
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggacagcctccaggacacagtggccctggaccatgggggctgctgccctgccctcagc
aggctggttcccagaggctttgggactgagatgtggactctctttgccctttctggaccc
ctgttcctgttccaggtgctgacttttatgatctacatcgtgagcactgtgttctgcggg
cacctgggcaaggtggagctggcatcggtgaccctcgcggtggcctttgtcaatgtctgc
ggagtttctgtaggagttggtttgtcttcggcatgtgacaccttgatgtctcagagcttc
ggcagccccaacaagaagcacgtgggcgtgatcctgcagcggggcgcgctggtcctgctc
ctctgctgcctcccttgctgggcgctcttcctcaacacccagcacatcctgctgctcttc
cggcaggacccggacgtgtccaggttgacccaggactatgtaatgattttcattccagga
cttccggtgatttttctttacaatctgctggcaaaatatttgcaaaatcagggatggctg
aaggggcaggaggaggagtccccattccaaaccccgggtttgtccatcctccatccatct
cactcacaccttagcagggccagttttcatttatttcagaagatcacctggccccaagtc
ctcagtggtgtggtgggcaactgtgtcaacggtgtggccaactatgccctggtttctgtg
ctgaacctgggggtcaggggctccgcctatgccaacatcatctcccagtttgcacagacc
gtcttcctccttctctacattgtgctgaagaagctgcacctggagacgtgggcaggttgg
tccagccagtgcctgcaggactggggccccttcttctccctggctgtccccagcatgctc
atgatctgtgttgagtggtgggcctatgagatcgggagcttcctcatggggctgctcagt
gtggtggatctctctgcccaggctgtcatctacgaggtggccactgtgacctacatgatt
cccttggggctcagcatcggggtctgtgtccgagtggggatggctctgggggctgcggat
actgtgcaggccaagcgctcggccgtctcgggcgtgctcagcatagttggcatttccctg
gtcctgggcaccctgataagcatcctgaaaaatcagctggggcatatttttaccaatgat
gaagatgtcattgccctggtgagccaggtcttgccggtttatagtgtctttcacgtgttt
gaggccatctgttgtgtctatggcggagttctgagaggaactgggaagcaggcctttggt
gccgctgtgaatgccatcacatattacatcatcggcctaccactgggcatccttctgacc
tttgtggtcagaatgagaatcatgggcctctggctgggcatgctggcctgtgtcttcctg
gcaactgctgcctttgttgcttatactgcccggctggactggaagcttgctgcagaggag
gctaagaaacattcaggccggcagcagcagcagagagcagagagcactgcaaccagacct
gggcctgagaaagcagtcctatcttcagtggctacaggcagttcccctggcattaccttg
acaacgtattcaaggtctgagtgccacgtggacttcttcaggactccagaggaggcccac
gccctttcagctcctaccagcagactatcagtgaaacagctggtcatccgccgtggggct
gctctgggggcggcgtcagccacactgatggtggggctcacggtcaggatcctagccacc
aggcactag

DBGET integrated database retrieval system