KEGG   Homo sapiens (human): 1470Help
Entry
1470              CDS       T01001                                 

Gene name
CST2
Definition
(RefSeq) cystatin SA
  KO
K13898  cystatin-SA
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    1470 (CST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin SQAPI
Motif
Other DBs
NCBI-GeneID: 1470
NCBI-ProteinID: NP_001313
OMIM: 123856
HGNC: 2474
Ensembl: ENSG00000170369
Vega: OTTHUMG00000032086
Pharos: P09228(Tbio)
UniProt: P09228
Position
20p11.21
AA seq 141 aa AA seqDB search
MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATE
DEYYRRLLRVLRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF
QIYEVPWEDRMSLVNSRCQEA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcccctgtgcaccctgctgctcctgctggccacccaggctgtggccctggcc
tggagcccccaggaggaggacaggataatcgagggtggcatctatgatgcagacctcaat
gatgagcgggtacagcgtgcccttcactttgtcatcagcgagtataacaaggccactgaa
gatgagtactacagacgcctgctgcgggtgctacgagccagggagcagatcgtgggcggg
gtgaattacttcttcgacatagaggtgggccgaaccatatgtaccaagtcccagcccaac
ttggacacctgtgccttccatgaacagccagaactgcagaagaaacagttgtgctctttc
cagatctacgaagttccctgggaggacagaatgtccctggtgaattccaggtgtcaagaa
gcctag

DBGET integrated database retrieval system