KEGG   Homo sapiens (human): 1470Help
Entry
1470              CDS       T01001                                 

Gene name
CST2
Definition
cystatin SA
Orthology
K13898  
cystatin-SA
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Class
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p11.21
AA seq 141 aa AA seqDB search
MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATE
DEYYRRLLRVLRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF
QIYEVPWEDRMSLVNSRCQEA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcccctgtgcaccctgctgctcctgctggccacccaggctgtggccctggcc
tggagcccccaggaggaggacaggataatcgagggtggcatctatgatgcagacctcaat
gatgagcgggtacagcgtgcccttcactttgtcatcagcgagtataacaaggccactgaa
gatgagtactacagacgcctgctgcgggtgctacgagccagggagcagatcgtgggcggg
gtgaattacttcttcgacatagaggtgggccgaaccatatgtaccaagtcccagcccaac
ttggacacctgtgccttccatgaacagccagaactgcagaagaaacagttgtgctctttc
cagatctacgaagttccctgggaggacagaatgtccctggtgaattccaggtgtcaagaa
gcctag

DBGET integrated database retrieval system