KEGG   Homo sapiens (human): 1472Help
Entry
1472              CDS       T01001                                 

Gene name
CST4
Definition
(RefSeq) cystatin S
  KO
K13900  cystatin-S
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    1472 (CST4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin SQAPI
Motif
Other DBs
NCBI-GeneID: 1472
NCBI-ProteinID: NP_001890
OMIM: 123857
HGNC: 2476
Ensembl: ENSG00000101441
Vega: OTTHUMG00000032083
Pharos: P01036(Tbio)
UniProt: P01036
Position
20p11.21
AA seq 141 aa AA seqDB search
MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATE
DEYYRRPLQVLRAREQTFGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF
EIYEVPWEDRMSLVNSRCQEA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcctctgtgtaccctgctactcctgatggctaccctggctggggctctggcc
tcgagctccaaggaggagaataggataatcccaggtggcatctatgatgcagacctcaat
gatgagtgggtacagcgtgcccttcacttcgccatcagcgagtacaacaaggccaccgaa
gatgagtactacagacgcccgctgcaggtgctgcgagccagggagcagacctttgggggg
gtgaattacttcttcgacgtagaggtgggccgcaccatatgtaccaagtcccagcccaac
ttggacacctgtgccttccatgaacagccagaactgcagaagaaacagttgtgctctttc
gagatctacgaagttccctgggaggacagaatgtccctggtgaattccaggtgtcaagaa
gcctag

DBGET integrated database retrieval system