KEGG   Homo sapiens (human): 1472Help
Entry
1472              CDS       T01001                                 

Gene name
CST4
Definition
cystatin S
Orthology
K13900  
cystatin-S
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    1472 (CST4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p11.21
AA seq 141 aa AA seqDB search
MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATE
DEYYRRPLQVLRAREQTFGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF
EIYEVPWEDRMSLVNSRCQEA
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcccggcctctgtgtaccctgctactcctgatggctaccctggctggggctctggcc
tcgagctccaaggaggagaataggataatcccaggtggcatctatgatgcagacctcaat
gatgagtgggtacagcgtgcccttcacttcgccatcagcgagtacaacaaggccaccgaa
gatgagtactacagacgcccgctgcaggtgctgcgagccagggagcagacctttgggggg
gtgaattacttcttcgacgtagaggtgggccgcaccatatgtaccaagtcccagcccaac
ttggacacctgtgccttccatgaacagccagaactgcagaagaaacagttgtgctctttc
gagatctacgaagttccctgggaggacagaatgtccctggtgaattccaggtgtcaagaa
gcctag

DBGET integrated database retrieval system