KEGG   Homo sapiens (human): 1473Help
Entry
1473              CDS       T01001                                 

Gene name
CST5
Definition
cystatin D
Orthology
K13901  
cystatin-D
Organism
hsa  Homo sapiens (human)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    1473 (CST5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p11.21
AA seq 142 aa AA seqDB search
MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVIN
KDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCS
FQINEVPWEDKISILNYKCRKV
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggcccatgcacaccccactgctgctgctgactgccttgatggtggccgtggcc
gggagtgcctcggcccaatctaggaccttggcaggtggcatccatgccacagacctcaat
gacaagagtgtgcagtgtgccctggactttgccatcagcgagtacaacaaggtcattaat
aaggatgagtactacagccgccctctgcaggtgatggctgcctaccagcagatcgtgggt
ggggtgaactactacttcaatgtgaagttcggtcgaaccacatgcaccaagtcccagccc
aacttggacaactgtcccttcaatgaccagccaaaactgaaagaggaagagttctgctct
ttccagatcaatgaagttccctgggaggataaaatttccattctgaactacaagtgccgg
aaagtctag

DBGET integrated database retrieval system