KEGG   Homo sapiens (human): 1473Help
Entry
1473              CDS       T01001                                 

Gene name
CST5
Definition
(RefSeq) cystatin D
  KO
K13901  cystatin-D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    1473 (CST5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin SQAPI
Motif
Other DBs
NCBI-GeneID: 1473
NCBI-ProteinID: NP_001891
OMIM: 123858
HGNC: 2477
Ensembl: ENSG00000170367
Vega: OTTHUMG00000032089
Pharos: P28325(Tbio)
UniProt: P28325
Structure
PDB: 

Jmol
Position
20p11.21
AA seq 142 aa AA seqDB search
MMWPMHTPLLLLTALMVAVAGSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVIN
KDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCS
FQINEVPWEDKISILNYKCRKV
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggcccatgcacaccccactgctgctgctgactgccttgatggtggccgtggcc
gggagtgcctcggcccaatctaggaccttggcaggtggcatccatgccacagacctcaat
gacaagagtgtgcagtgtgccctggactttgccatcagcgagtacaacaaggtcattaat
aaggatgagtactacagccgccctctgcaggtgatggctgcctaccagcagatcgtgggt
ggggtgaactactacttcaatgtgaagttcggtcgaaccacatgcaccaagtcccagccc
aacttggacaactgtcccttcaatgaccagccaaaactgaaagaggaagagttctgctct
ttccagatcaatgaagttccctgggaggataaaatttccattctgaactacaagtgccgg
aaagtctag

DBGET integrated database retrieval system