KEGG   Homo sapiens (human): 147660Help
Entry
147660            CDS       T01001                                 

Gene name
ZNF578
Definition
(RefSeq) zinc finger protein 578
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 KRAB zf-C2H2_4 zf-C2H2_6 Zn-ribbon_8 zf-H2C2_5 zf-C2H2_11
Motif
Other DBs
NCBI-GeneID: 147660
NCBI-ProteinID: NP_001093164
HGNC: 26449
Ensembl: ENSG00000258405
Vega: OTTHUMG00000156468
Pharos: Q96N58(Tdark)
UniProt: Q96N58 Q3MI94
Position
19q13.41
AA seq 590 aa AA seqDB search
MLHEEAAQKRKGKEPGMALPQGRLTFRDVAIEFSLAEWKFLNPAQRALYREVMLENYRNL
EAVDISSKRMMKEVLSTGQGNTEVIHTGMLQRHESYHTGDFCFQEIEKDIHDFEFQSQKD
ERNGHEASMPKIKELMGSTDRHDQRHAGNKPIKDQLGLSFHLHLPELHIFQPEEKIANQV
EKSVNDASSISTSQRISCRPETHTPNNYGNNFFHSSLLTQKQEVHMREKSFQCNETGEAF
NCSSFVRKHQIIHLGEKQYKFDICGKVFNEKRYLARHRRCHTSEKPYKCNECGKSFSYKS
SLTCHRRCHTGEKPYKCNECGKSFSYKSSLTCHHRCHTGEKPYKCNECGKSFSYKSSLRC
HRRLHTGIKPYKCNECGKMFGQNSTLVIHKAIHTGEKPYKCNECGKAFNQQSHLSRHHRL
HTGEKPYKCNDCGKAFIHQSSLARHHRLHTGEKSYKCEECDRVFSQKSNLERHKIIHTGE
KPYKCNECHKTFSHRSSLPCHRRLHSGEKPYKCNECGKTFNVQSHLSRHHRLHTGEKPYK
CKVCDKAFMCHSYLANHTRIHSGEKPYKCNECGKAHNHLIDSSIKPCMSS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgttacatgaggaagcagctcagaagaggaaaggaaaggagccaggcatggctcttcct
cagggacgcttgactttcagggatgtggctatagaattctcattggcagagtggaaattc
ctgaaccctgcgcagagggctttgtacagggaagtgatgttggagaactacaggaacctg
gaggctgtggatatctcttccaaacgcatgatgaaggaggtcttgtcaacagggcaaggc
aatacagaagtgatccacacagggatgttgcaaagacatgaaagttatcacactggagat
ttttgcttccaggaaattgaaaaagatattcatgactttgagtttcagtcacaaaaagat
gaaagaaatggccatgaagcatccatgccaaaaatcaaagagttgatgggtagcacagac
cgacatgatcaaaggcatgctggaaacaagcctattaaagatcagcttggattaagcttt
catttgcatcttcctgaactccacatatttcagcccgaagagaaaattgctaatcaagtg
gagaagtctgtcaacgatgcttcctcaatttcaacatcccaaagaatttcttgtaggcct
gaaacacatactcctaataactatgggaataattttttccattcatcattactcacacaa
aaacaggaagtacacatgagagaaaaatctttccaatgtaatgagactggcgaagccttt
aattgtagctcatttgtaaggaaacatcagataatccatttaggagaaaaacaatataaa
tttgatatatgtggcaaagtctttaatgagaagcgataccttgcacgccatcgtagatgt
cacactagtgagaaaccttacaagtgtaatgaatgtggaaagtccttcagttacaagtca
tccctgacatgccatcgtagatgtcacactggtgagaaaccttacaagtgtaatgaatgt
ggaaagtccttcagttacaagtcatcccttacatgccatcataggtgtcacactggtgag
aaaccttacaagtgtaatgaatgtggaaagtccttcagttacaagtcatcccttagatgc
catcgtagacttcatactggaataaaaccttacaagtgtaatgagtgtggcaagatgttt
ggtcaaaattcaacccttgtaattcataaggcaattcatactggagagaaaccttacaag
tgtaatgaatgtggcaaggcttttaatcaacaatcacacctttcacgtcatcatagactt
catactggagagaaaccttacaagtgtaatgactgtggtaaggcttttattcatcagtca
agccttgcacgtcatcatagacttcatactggagagaaatcttacaaatgtgaagaatgt
gacagagttttcagtcagaaatcaaaccttgagagacacaagataattcatactggagag
aaaccttacaagtgtaatgagtgtcacaagaccttcagtcacaggtcatctcttccatgc
catcgtagacttcatagtggtgagaaaccttacaagtgtaatgaatgtgggaagactttt
aatgtacagtcacacctttcacgtcatcatagacttcatactggagagaaaccttacaaa
tgtaaggtttgtgacaaggctttcatgtgccattcttatctggcaaaccatactagaatt
catagcggagagaaaccttacaagtgtaatgagtgtggtaaggctcacaatcacttgatt
gattcatcaatcaagccttgcatgtcatcatag

DBGET integrated database retrieval system