KEGG   Homo sapiens (human): 1478Help
Entry
1478              CDS       T01001                                 

Gene name
CSTF2, CstF-64
Definition
cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa
Orthology
K14407  
cleavage stimulation factor subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq22.1
AA seq 577 aa AA seqDB search
MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETIS
PEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMR
IVDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAQSLGGMHVN
GAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQAQVGMPGSGPVSMERGQVPMQ
DPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQGPPMHHVP
GHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAM
EARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPS
GMQGPSPINMGAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAAL
IMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtttgactgtgagagacccagcggtggatcgttctctacgttctgtgttcgtg
gggaacattccttatgaagctactgaagagcagttgaaggacatcttttctgaggttgga
cctgttgttagtttcagattggtatacgatagagagacaggaaagccaaagggttatggc
ttctgtgaataccaagaccaagagacagcacttagtgccatgcggaacctgaatgggcgc
gaattcagtgggagagcacttcgagtggacaatgctgccagtgaaaagaacaaagaagag
ctgaagagccttggcactggtgcccctgtcattgagtcaccttatggagagaccatcagt
cctgaggatgcccctgagtccattagcaaagcagttgccagccttccaccagagcagatg
tttgagctgatgaaacaaatgaagctctgtgtccagaatagtccccaggaggcacggaac
atgttacttcagaaccctcaactggcttatgctttgctgcaagcacaggtagtgatgaga
attgtggatccggaaattgccctgaaaattctgcatcgccagacaaatatcccaacgctg
attgcaggcaaccctcagccagtccatggtgctgggcctggctcaggatccaatgtgtca
atgaaccagcagaatcctcaggcccctcaggcccagtctttgggtggaatgcatgtcaat
ggcgcacctcctctgatgcaagcttctatgcagggtggagttccagcaccagggcaaatg
ccagctgctgtcacaggacctggccctggttccttagctcctggaggaggaatgcaggct
caggttggaatgccaggaagtggaccagtgtccatggaacgggggcaagtgccgatgcaa
gaccccagagcagctatgcagcggggatccttgcctgcgaatgtcccaacccctcgaggc
ttgttaggagatgctccgaatgatccacggggaggcactttactttctgtaactggagag
gtagagcctagaggttacttgggaccacctcatcagggtccacccatgcaccatgtccct
ggccatgagagccgaggaccacccccacatgaactgaggggagggccattacccgagccc
agacctctaatggcagaaccaagaggacccatgctagatcagaggggtccacccttggat
ggcagaggtggaagggatccccgaggaatagatgcacgagggatggaggcccgagccatg
gaggcaagagggttagatgccagaggattagaggcccgtgcaatggaggcccgtgcgatg
gaagctcgtgcaatggaggcccgagcgatggaggcccgtgcaatggaagtccgagggatg
gaggccagaggcatggataccagaggcccagtgcctggccccagaggacctatacctagt
ggaatgcagggtcccagtccaattaacatgggggcggttgtcccccagggatccagacag
gtcccagtcatgcagggaacaggaatgcaaggagcaagtatacagggtggaagccagcct
ggcggctttagtcccgggcagaaccaagtcactccacaggatcatgagaaggctgctttg
attatgcaggttctacaactgactgcagaccagattgccatgttgcctcctgagcaaagg
cagagtatcctgattttaaaggaacaaatacagaaatccactggagcaccttga

DBGET integrated database retrieval system