KEGG   Homo sapiens (human): 1479Help
Entry
1479              CDS       T01001                                 

Gene name
CSTF3, CSTF-77
Definition
cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
Orthology
K14408  
cleavage stimulation factor subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    1479 (CSTF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p13
AA seq 103 aa AA seqDB search
MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQ
FPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagacggagccacggagcaggcagctgagtatgtcccagagaaggtgaagaaa
gcggaaaagaaattagaagagaatccatatgaccttgatgcttggagcattctcattcga
gaggcacagaatcaacctatagacaaagcacggaagacttatgaacgccttgttgcccag
ttccccagttctggcagattctggaaactgtacattgaagcagaggttactattttattt
tattttttcttatatcagtattgcagcattcactgtagtgatagaaaacaagttaggaac
atagccaattag

DBGET integrated database retrieval system