KEGG   Homo sapiens (human): 147991Help
Entry
147991            CDS       T01001                                 

Gene name
DPY19L3
Definition
dpy-19-like 3 (C. elegans)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.11
AA seq 716 aa AA seqDB search
MMSIRQRREIRATEVSEDFPAQEENVKLENKLPSGCTSRRLWKILSLTIGGTIALCIGLL
TSVYLATLHENDLWFSNIKEVEREISFRTECGLYYSYYKQMLQAPTLVQGFHGLIYDNKT
ESMKTINLLQRMNIYQEVFLSILYRVLPIQKYLEPVYFYIYTLFGLQAIYVTALYITSWL
LSGTWLSGLLAAFWYVTNRIDTTRVEFTIPLRENWALPFFAIQIAAITYFLRPNLQPLSE
RLTLLAIFISTFLFSLTWQFNQFMMLMQALVLFTLDSLDMLPAVKATWLYGIQITSLLLV
CILQFFNSMILGSLLISFNLSVFIARKLQKNLKTGSFLNRLGKLLLHLFMVLCLTLFLNN
IIKKILNLKSDEHIFKFLKAKFGLGATRDFDANLYLCEEAFGLLPFNTFGRLSDTLLFYA
YIFVLSITVIVAFVVAFHNLSDSTNQQSVGKMEKGTVDLKPETAYNLIHTILFGFLALST
MRMKYLWTSHMCVFASFGLCSPEIWELLLKSVHLYNPKRICIMRYSVPILILLYLCYKFW
PGMMDELSELREFYDPDTVELMNWINSNTPRKAVFAGSMQLLAGVKLCTGRTLTNHPHYE
DSSLRERTRAVYQIYAKRAPEEVHALLRSFGTDYVILEDSICYERRHRRGCRLRDLLDIA
NGHMMDGPGENDPDLKPADHPRFCEEIKRNLPPYVAYFTRVFQNKTFHVYKLSRNK
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccatccggcaaagaagagaaataagagccacagaagtttctgaagactttcca
gcccaagaagaaaatgtgaagttggaaaataaattgccatctggttgtaccagtagaaga
ttatggaagattttgtcattgacaattggtggaaccattgccctttgcattggacttctt
acatctgtctaccttgccacgttacatgaaaatgatttatggttttctaatattaaggaa
gtggagcgagaaatctcattcagaacagagtgtggcctgtattactcctactacaagcag
atgctgcaggctccaaccctcgtgcaaggttttcatggcctaatatatgataataaaact
gaatctatgaagacaattaacctccttcagcgaatgaatatttaccaagaggtttttctc
agtattttatatagagttctacccatacagaaatatttagagccagtttatttttatatt
tacaccttatttgggctccaggcgatctatgtcacagctctctacataaccagctggcta
ctcagtggtacatggctgtcaggactgttggcagctttctggtatgtcacaaatagaata
gataccacaagagttgagtttaccatcccactgagggagaactgggcgctgccattcttt
gcaattcagatagcagcaattacatatttcctgagaccaaacttacagcctctttctgaa
aggctgacacttcttgccattttcatatcaacttttctctttagtctgacatggcaattt
aatcaatttatgatgctgatgcaagcattagtgctgttcacactggactccctggacatg
ctgccagcagtgaaggcgacatggctgtatggaatacagataacaagtttactcctggtc
tgcattcttcagttttttaattccatgattcttggatcactgcttatcagttttaacctt
tcagtattcattgcaagaaaacttcagaaaaatctgaaaactggaagcttccttaatagg
cttgggaaacttttgttacatttatttatggttttatgtttgacactttttctcaacaac
ataattaagaaaattcttaacctgaagtcagatgaacacatatttaaatttctgaaggca
aaatttgggcttggagcaacaagggattttgatgcaaatctctatctgtgtgaagaagct
tttggcctcctgccttttaatacatttggaaggctttcagatactctgcttttttatgct
tacatattcgttctgtccatcacagtgattgtagcattcgttgttgcctttcataatctc
agtgattctacaaatcaacaatccgtgggtaaaatggaaaaaggcacagttgacctgaaa
ccagaaactgcctacaacttaatacataccattctgtttggattcttggcattgagtaca
atgagaatgaagtacctctggacgtcacacatgtgtgtgttcgcatcattcggcctatgt
agccctgaaatatgggagttacttctgaagtcagtccatctttataacccaaagaggata
tgtataatgcgatattcagtaccgatattaatactgctgtatctatgctataagttctgg
ccaggaatgatggatgaactctccgagttgagagaattctatgatccagatacagtggag
ctgatgaactggattaactctaacactccaagaaaggctgtgtttgcgggaagcatgcag
ttgctggccggagtcaagctgtgcacgggaaggaccctaaccaaccacccgcactatgaa
gacagcagcctgagagagcggaccagagcggtttatcagatatatgccaagagggcacca
gaggaagtgcatgccctcctaaggtccttcggcactgactacgtaatcctggaagacagc
atctgctacgagcggaggcaccgccggggctgccgactccgggacctgctggacattgcc
aacggccacatgatggatggcccaggagagaatgatcctgatttgaaacctgcagaccac
cctcgcttctgtgaagagatcaaaagaaacctgcctccctacgtggcctacttcaccaga
gtgttccagaacaaaaccttccacgtttacaagctgtccagaaacaagtag

DBGET integrated database retrieval system