KEGG   Homo sapiens (human): 147991Help
Entry
147991            CDS       T01001                                 

Gene name
DPY19L3
Definition
(RefSeq) dpy-19 like C-mannosyltransferase 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Dpy19
Motif
Other DBs
NCBI-GeneID: 147991
NCBI-ProteinID: NP_001166245
OMIM: 613894
HGNC: 27120
Ensembl: ENSG00000178904
Vega: OTTHUMG00000180222
Pharos: Q6ZPD9(Tdark)
UniProt: Q6ZPD9
Position
19q13.11
AA seq 716 aa AA seqDB search
MMSIRQRREIRATEVSEDFPAQEENVKLENKLPSGCTSRRLWKILSLTIGGTIALCIGLL
TSVYLATLHENDLWFSNIKEVEREISFRTECGLYYSYYKQMLQAPTLVQGFHGLIYDNKT
ESMKTINLLQRMNIYQEVFLSILYRVLPIQKYLEPVYFYIYTLFGLQAIYVTALYITSWL
LSGTWLSGLLAAFWYVTNRIDTTRVEFTIPLRENWALPFFAIQIAAITYFLRPNLQPLSE
RLTLLAIFISTFLFSLTWQFNQFMMLMQALVLFTLDSLDMLPAVKATWLYGIQITSLLLV
CILQFFNSMILGSLLISFNLSVFIARKLQKNLKTGSFLNRLGKLLLHLFMVLCLTLFLNN
IIKKILNLKSDEHIFKFLKAKFGLGATRDFDANLYLCEEAFGLLPFNTFGRLSDTLLFYA
YIFVLSITVIVAFVVAFHNLSDSTNQQSVGKMEKGTVDLKPETAYNLIHTILFGFLALST
MRMKYLWTSHMCVFASFGLCSPEIWELLLKSVHLYNPKRICIMRYSVPILILLYLCYKFW
PGMMDELSELREFYDPDTVELMNWINSNTPRKAVFAGSMQLLAGVKLCTGRTLTNHPHYE
DSSLRERTRAVYQIYAKRAPEEVHALLRSFGTDYVILEDSICYERRHRRGCRLRDLLDIA
NGHMMDGPGENDPDLKPADHPRFCEEIKRNLPPYVAYFTRVFQNKTFHVYKLSRNK
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccatccggcaaagaagagaaataagagccacagaagtttctgaagactttcca
gcccaagaagaaaatgtgaagttggaaaataaattgccatctggttgtaccagtagaaga
ttatggaagattttgtcattgacaattggtggaaccattgccctttgcattggacttctt
acatctgtctaccttgccacgttacatgaaaatgatttatggttttctaatattaaggaa
gtggagcgagaaatctcattcagaacagagtgtggcctgtattactcctactacaagcag
atgctgcaggctccaaccctcgtgcaaggttttcatggcctaatatatgataataaaact
gaatctatgaagacaattaacctccttcagcgaatgaatatttaccaagaggtttttctc
agtattttatatagagttctacccatacagaaatatttagagccagtttatttttatatt
tacaccttatttgggctccaggcgatctatgtcacagctctctacataaccagctggcta
ctcagtggtacatggctgtcaggactgttggcagctttctggtatgtcacaaatagaata
gataccacaagagttgagtttaccatcccactgagggagaactgggcgctgccattcttt
gcaattcagatagcagcaattacatatttcctgagaccaaacttacagcctctttctgaa
aggctgacacttcttgccattttcatatcaacttttctctttagtctgacatggcaattt
aatcaatttatgatgctgatgcaagcattagtgctgttcacactggactccctggacatg
ctgccagcagtgaaggcgacatggctgtatggaatacagataacaagtttactcctggtc
tgcattcttcagttttttaattccatgattcttggatcactgcttatcagttttaacctt
tcagtattcattgcaagaaaacttcagaaaaatctgaaaactggaagcttccttaatagg
cttgggaaacttttgttacatttatttatggttttatgtttgacactttttctcaacaac
ataattaagaaaattcttaacctgaagtcagatgaacacatatttaaatttctgaaggca
aaatttgggcttggagcaacaagggattttgatgcaaatctctatctgtgtgaagaagct
tttggcctcctgccttttaatacatttggaaggctttcagatactctgcttttttatgct
tacatattcgttctgtccatcacagtgattgtagcattcgttgttgcctttcataatctc
agtgattctacaaatcaacaatccgtgggtaaaatggaaaaaggcacagttgacctgaaa
ccagaaactgcctacaacttaatacataccattctgtttggattcttggcattgagtaca
atgagaatgaagtacctctggacgtcacacatgtgtgtgttcgcatcattcggcctatgt
agccctgaaatatgggagttacttctgaagtcagtccatctttataacccaaagaggata
tgtataatgcgatattcagtaccgatattaatactgctgtatctatgctataagttctgg
ccaggaatgatggatgaactctccgagttgagagaattctatgatccagatacagtggag
ctgatgaactggattaactctaacactccaagaaaggctgtgtttgcgggaagcatgcag
ttgctggccggagtcaagctgtgcacgggaaggaccctaaccaaccacccgcactatgaa
gacagcagcctgagagagcggaccagagcggtttatcagatatatgccaagagggcacca
gaggaagtgcatgccctcctaaggtccttcggcactgactacgtaatcctggaagacagc
atctgctacgagcggaggcaccgccggggctgccgactccgggacctgctggacattgcc
aacggccacatgatggatggcccaggagagaatgatcctgatttgaaacctgcagaccac
cctcgcttctgtgaagagatcaaaagaaacctgcctccctacgtggcctacttcaccaga
gtgttccagaacaaaaccttccacgtttacaagctgtccagaaacaagtag

DBGET integrated database retrieval system