KEGG   Homo sapiens (human): 148022Help
Entry
148022            CDS       T01001                                 

Gene name
TICAM1, IIAE6, MyD88-3, PRVTIRB, TICAM-1, TRIF
Definition
toll-like receptor adaptor molecule 1
Orthology
K05842  
toll-like receptor adapter molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Pertussis
Chagas disease (American trypanosomiasis)
Hepatitis C
Hepatitis B
Influenza A
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:hsa05168]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 712 aa AA seqDB search
MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARIS
LEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQE
AVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPR
PIDGVSDWSQGCSLRSTGSPASLASNLEISQSPTMPFLSLHRSPHGPSKLCDDPQASLVP
EPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAPDATSTGLPDTPAAPETSTNY
PVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCPPTPTTPETSP
PPPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALG
VPDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQ
GSPDCVIPFLPLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMW
RKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTG
APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQS
PAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcacaggcccatcacttcctagcgccttcgacattctaggtgcagcaggccag
gacaagctcttgtatctgaagcacaaactgaagaccccacgcccaggctgccaggggcag
gacctcctgcatgccatggttctcctgaagctgggccaggaaactgaggccaggatctct
ctagaggcattgaaggccgatgcggtggcccggctggtggcccgccagtgggctggcgtg
gacagcaccgaggacccagaggagcccccagatgtgtcctgggctgtggcccgcttgtac
cacctgctggctgaggagaagctgtgccccgcctcgctgcgggacgtggcctaccaggaa
gccgtccgcaccctcagctccagggacgaccaccggctgggggaacttcaggatgaggcc
cgaaaccggtgtgggtgggacattgctggggatccagggagcatccggacgctccagtcc
aatctgggctgcctcccaccatcctcggctttgccctctgggaccaggagcctcccacgc
cccattgacggtgtttcggactggagccaagggtgctccctgcgatccactggcagccct
gcctccctggccagcaacttggaaatcagccagtcccctaccatgcccttcctcagcctg
caccgcagcccacatgggcccagcaagctctgtgacgacccccaggccagcttggtgccc
gagcctgtccccggtggctgccaggagcctgaggagatgagctggccgccatcgggggag
attgccagcccaccagagctgccaagcagcccacctcctgggcttcccgaagtggcccca
gatgcaacctccactggcctccctgatacccccgcagctccagaaaccagcaccaactac
ccagtggagtgcaccgaggggtctgcaggcccccagtctctccccttgcctattctggag
ccggtcaaaaacccctgctctgtcaaagaccagacgccactccaactttctgtagaagat
accacctctccaaataccaagccgtgcccacctactcccaccaccccagaaacatcccct
cctcctcctcctcctcctccttcatctactccttgttcagctcacctgaccccctcctcc
ctgttcccttcctccctggaatcatcatcggaacagaaattctataactttgtgatcctc
cacgccagggcagacgaacacatcgccctgcgggttcgggagaagctggaggcccttggc
gtgcccgacggggccaccttctgcgaggatttccaggtgccggggcgcggggagctgagc
tgcctgcaggacgccatagaccactcagctttcatcatcctacttctcacctccaacttc
gactgtcgcctgagcctgcaccaggtgaaccaagccatgatgagcaacctcacgcgacag
gggtcgccagactgtgtcatccccttcctgcccctggagagctccccggcccagctcagc
tccgacacggccagcctgctctccgggctggtgcggctggacgaacactcccagatcttc
gccaggaaggtggccaacaccttcaagccccacaggcttcaggcccgaaaggccatgtgg
aggaaggaacaggacacccgagccctgcgggaacagagccaacacctggacggtgagcgg
atgcaggcggcggcactgaacgcagcctactcagcctacctccagagctacttgtcctac
caggcacagatggagcagctccaggtggcttttgggagccacatgtcatttgggactggg
gcgccctatggggctcgaatgccctttgggggccaggtgcccctgggagccccgccaccc
tttcccacttggccggggtgcccgcagccgccacccctgcacgcatggcaggctggcacc
cccccaccgccctccccacagccagcagcctttccacagtcactgcccttcccgcagtcc
ccagccttccctacggcctcacccgcaccccctcagagcccagggctgcaacccctcatt
atccaccacgcacagatggtacagctggggctgaacaaccacatgtggaaccagagaggg
tcccaggcgcccgaggacaagacgcaggaggcagaatga

DBGET integrated database retrieval system