KEGG   Homo sapiens (human): 148327Help
Entry
148327            CDS       T01001                                 

Gene name
CREB3L4, AIBZIP, ATCE1, CREB3, CREB4, JAL, hJAL
Definition
cAMP responsive element binding protein 3-like 4
Orthology
K09048  
cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    148327 (CREB3L4)
   04024 cAMP signaling pathway
    148327 (CREB3L4)
   04022 cGMP - PKG signaling pathway
    148327 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    148327 (CREB3L4)
   04152 AMPK signaling pathway
    148327 (CREB3L4)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    148327 (CREB3L4)
   04915 Estrogen signaling pathway
    148327 (CREB3L4)
   04918 Thyroid hormone synthesis
    148327 (CREB3L4)
   04916 Melanogenesis
    148327 (CREB3L4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    148327 (CREB3L4)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    148327 (CREB3L4)
  Nervous system
   04725 Cholinergic synapse
    148327 (CREB3L4)
   04728 Dopaminergic synapse
    148327 (CREB3L4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    148327 (CREB3L4)
   05215 Prostate cancer
    148327 (CREB3L4)
  Neurodegenerative diseases
   05016 Huntington's disease
    148327 (CREB3L4)
  Substance dependence
   05030 Cocaine addiction
    148327 (CREB3L4)
   05031 Amphetamine addiction
    148327 (CREB3L4)
   05034 Alcoholism
    148327 (CREB3L4)
  Infectious diseases
   05161 Hepatitis B
    148327 (CREB3L4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    148327 (CREB3L4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21.3
AA seq 395 aa AA seqDB search
MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGL
QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAG
ALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCTT
LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
LLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPP
GAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatctcggaatccctgacctgctggacgcgtggctggagcccccagaggatatcttc
tcgacaggatccgtcctggagctgggactccactgcccccctccagaggttccggtaact
aggctacaggaacagggactgcaaggctggaagtccggtggggaccgtggctgtggcctt
caagagagtgagcctgaagatttcttgaagcttttcattgatcccaatgaggtgtactgc
tcagaagcatctcctggcagtgacagtggcatctctgaggacccctgccatccagacagt
ccccctgcccccagggcaaccagttctcctatgctctatgaggttgtctatgaggcaggg
gccctggagaggatgcagggggaaactgggccaaatgtaggccttatctccatccagcta
gatcagtggagcccagcatttatggtgcctgattcctgcatggtcagtgagctgcccttt
gatgctcatgcccacatcctgcccagagcaggcaccgtagccccagtgccctgtacaacc
ctgctgccctgtcaaaccctgttcctgaccgatgaggagaagcgtctgctggggcaggaa
ggggtttccctgccctctcacctgcccctcaccaaggcagaggagagggtcctcaagaag
gtcaggaggaaaatccgtaacaagcagtcagctcaggacagtcggcggcggaagaaggag
tacattgatgggctggagagcagggtggcagcctgttctgcacagaaccaagaattacag
aaaaaagtccaggagctggagaggcacaacatctccttggtagctcagctccgccagctg
cagacgctaattgctcaaacttccaacaaagctgcccagaccagcacttgtgttttgatt
cttcttttttccctggctctcatcatcctgcccagcttcagtccattccagagtcgacca
gaagctgggtctgaggattaccagcctcacggagtgacttccagaaatatcctgacccac
aaggacgtaacagaaaatctggagacccaagtggtagagtccagactgagggagccacct
ggagccaaggatgcaaatggctcaacaaggacactgcttgagaagatgggagggaagcca
agacccagtgggcgcatccggtccgtgctgcatgcagatgagatgtga

DBGET integrated database retrieval system