KEGG   Homo sapiens (human): 1487Help
Entry
1487              CDS       T01001                                 

Gene name
CTBP1, BARS
Definition
C-terminal binding protein 1
Orthology
K04496  
C-terminal binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Notch signaling pathway
Pathways in cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1487 (CTBP1)
   04330 Notch signaling pathway
    1487 (CTBP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1487 (CTBP1)
   05220 Chronic myeloid leukemia
    1487 (CTBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p16
AA seq 429 aa AA seqDB search
MSGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAV
GALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADS
TLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVAL
RAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFT
VKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLI
CTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATHWASMDPAVVH
PELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEA
DRDHASDQL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcgtccgacctccgatcatgaacgggcccctgcacccgcggcccctggtggca
ttgctggatggccgggactgcacagtggagatgcccatcctgaaggacgtggccactgtg
gccttctgcgacgcgcagtccacgcaggagatccatgagaaggtcctgaacgaggctgtg
ggggccctgatgtaccacaccatcactctcaccagggaggacctggagaagttcaaagcc
ctccgcatcatcgtccggattggcagtggttttgacaacatcgacatcaagtcggccggg
gatttaggcattgccgtctgcaacgtgcccgcggcgtctgtggaggagacggccgactcg
acgctgtgccacatcctgaacctgtaccggcgggccacctggctgcaccaggcgctgcgg
gagggcacacgagtccagagcgtcgagcagatccgcgaggtggcgtccggcgctgccagg
atccgcggggagaccttgggcatcatcggacttggtcgcgtggggcaggcagtggcgctg
cgggccaaggccttcggcttcaacgtgctcttctacgacccttacttgtcggatggcgtg
gagcgggcgctggggctgcagcgtgtcagcaccctgcaggacctgctcttccacagcgac
tgcgtgaccctgcactgcggcctcaacgagcacaaccaccacctcatcaacgacttcacc
gtcaagcagatgagacaaggggccttcctggtgaacacagcccggggtggcctggtggat
gagaaggcgctggcccaggccctgaaggagggccggatccgcggcgcggccctggatgtg
cacgagtcggaacccttcagctttagccagggccctctgaaggatgcacccaacctcatc
tgcaccccccatgctgcatggtacagcgagcaggcatccatcgagatgcgagaggaggcg
gcacgggagatccgcagagccatcacaggccggatcccagacagcctgaagaactgtgtc
aacaaggaccatctgacagccgccacccactgggccagcatggaccccgccgtcgtgcac
cctgagctcaatggggctgcctataggtaccctccgggcgtggtgggcgtggcccccact
ggcatcccagctgctgtggaaggtatcgtccccagcgccatgtccctgtcccacggcctg
ccccctgtggcccacccgccccacgccccttctcctggccaaaccgtcaagcccgaggcg
gatagagaccacgccagtgaccagttgtag

DBGET integrated database retrieval system