KEGG   Homo sapiens (human): 1488Help
Entry
1488              CDS       T01001                                 

Gene name
CTBP2
Definition
C-terminal binding protein 2
Orthology
K04496  
C-terminal binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Notch signaling pathway
Pathways in cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    1488 (CTBP2)
   04330 Notch signaling pathway
    1488 (CTBP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1488 (CTBP2)
   05220 Chronic myeloid leukemia
    1488 (CTBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q26.13
AA seq 445 aa AA seqDB search
MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG
IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS
LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE
FFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcccttgtggataagcacaaagtcaagagacagcgattggacagaatttgtgaaggt
atccgcccccagatcatgaacggccccctgcacccccgccccctggtggcgctgctggac
ggccgcgactgcactgtggagatgcccatcctgaaggacctggccactgtggccttctgt
gacgcgcagtcgacgcaggaaatccacgagaaggttctaaacgaagccgtgggcgccatg
atgtaccacaccatcaccctcaccagggaggacctggagaagttcaaggccctgagagtg
atcgtgcggataggcagtggctatgacaacgtggacatcaaggctgccggcgagctcgga
attgccgtgtgcaacatcccgtctgcagccgtggaagagacagcggactctaccatctgc
cacatcctcaacctgtaccggaggaacacgtggctgtaccaggcactgcgggaaggcacg
cgggttcagagcgtggagcagatccgcgaggtggcctcgggagcggcccgcatccgtggg
gagacgctgggcctcattggctttggtcgcacggggcaggcggttgcagttcgagccaag
gcctttggattcagcgtcatattttatgacccctacttgcaggatgggatcgagcggtcc
ctgggcgtgcagagggtctacaccctgcaggatttgctgtatcagagcgactgcgtctcc
ttgcactgcaatctcaacgaacataaccaccacctcatcaatgactttaccataaagcag
atgaggcagggagcattccttgtgaacgcagcccgtggcggcctggtggacgagaaagcc
ttagcacaagccctcaaggagggcaggatacgaggggcagccctcgacgtgcatgagtca
gagcccttcagctttgctcagggtccgttgaaagatgccccgaatctcatctgcactcct
cacactgcctggtacagtgagcaggcgtcactggagatgagggaggcagctgccaccgag
atccgccgagccatcacaggtcgcatcccagaaagcttaagaaattgtgtgaacaaggaa
ttctttgtcacatcagcgccttggtcagtaatagaccagcaagcaattcatcctgagctc
aatggtgccacatacagatatccgccaggcatcgtgggtgtggctccaggaggacttcct
gcagccatggaagggatcatccctggaggcatcccagtgactcacaacctcccgacagtg
gcacatccttcccaagcgccctctcccaaccagcccacaaaacacggggacaatcgagag
caccccaacgagcaatag

DBGET integrated database retrieval system