KEGG   Homo sapiens (human): 1488Help
Entry
1488              CDS       T01001                                 

Gene name
CTBP2
Definition
C-terminal binding protein 2
Orthology
K04496  
C-terminal binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Notch signaling pathway
Pathways in cancer
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q26.13
AA seq 445 aa AA seqDB search
MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFC
DAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELG
IAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRG
ETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVS
LHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGAALDVHES
EPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNCVNKE
FFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcccttgtggataagcacaaagtcaagagacagcgattggacagaatttgtgaaggt
atccgcccccagatcatgaacggccccctgcacccccgccccctggtggcgctgctggac
ggccgcgactgcactgtggagatgcccatcctgaaggacctggccactgtggccttctgt
gacgcgcagtcgacgcaggaaatccacgagaaggttctaaacgaagccgtgggcgccatg
atgtaccacaccatcaccctcaccagggaggacctggagaagttcaaggccctgagagtg
atcgtgcggataggcagtggctatgacaacgtggacatcaaggctgccggcgagctcgga
attgccgtgtgcaacatcccgtctgcagccgtggaagagacagcggactctaccatctgc
cacatcctcaacctgtaccggaggaacacgtggctgtaccaggcactgcgggaaggcacg
cgggttcagagcgtggagcagatccgcgaggtggcctcgggagcggcccgcatccgtggg
gagacgctgggcctcattggctttggtcgcacggggcaggcggttgcagttcgagccaag
gcctttggattcagcgtcatattttatgacccctacttgcaggatgggatcgagcggtcc
ctgggcgtgcagagggtctacaccctgcaggatttgctgtatcagagcgactgcgtctcc
ttgcactgcaatctcaacgaacataaccaccacctcatcaatgactttaccataaagcag
atgaggcagggagcattccttgtgaacgcagcccgtggcggcctggtggacgagaaagcc
ttagcacaagccctcaaggagggcaggatacgaggggcagccctcgacgtgcatgagtca
gagcccttcagctttgctcagggtccgttgaaagatgccccgaatctcatctgcactcct
cacactgcctggtacagtgagcaggcgtcactggagatgagggaggcagctgccaccgag
atccgccgagccatcacaggtcgcatcccagaaagcttaagaaattgtgtgaacaaggaa
ttctttgtcacatcagcgccttggtcagtaatagaccagcaagcaattcatcctgagctc
aatggtgccacatacagatatccgccaggcatcgtgggtgtggctccaggaggacttcct
gcagccatggaagggatcatccctggaggcatcccagtgactcacaacctcccgacagtg
gcacatccttcccaagcgccctctcccaaccagcccacaaaacacggggacaatcgagag
caccccaacgagcaatag

DBGET integrated database retrieval system