KEGG   Homo sapiens (human): 1489Help
Entry
1489              CDS       T01001                                 

Gene name
CTF1, CT-1, CT1
Definition
(RefSeq) cardiotrophin 1
  KO
K05422  
cardiotrophin 1
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    1489 (CTF1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1489 (CTF1)
Cytokines [BR:hsa04052]
 Class I cytokines (hematopoietin family)
  IL-6 receptor family
   1489 (CTF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 201 aa AA seqDB search
MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPS
FSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLR
RLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGL
YREWLSRTEGDLGQLLPGGSA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaagacccccagactgattcctcagtctcacttctt
ccccacttggaggccaagatccgtcagacacacagccttgcgcacctcctcaccaaatac
gctgagcagctgctccaggaatatgtgcagctccagggagaccccttcgggctgcccagc
ttctcgccgccgcggctgccggtggccggcctgagcgccccggctccgagccacgcgggg
ctgccagtgcacgagcggctgcggctggacgcggcggcgctggccgcgctgcccccgctg
ctggacgcagtgtgtcgccgccaggccgagctgaacccgcgcgcgccgcgcctgctgcgc
cgcctggaggacgcggcgcgccaggcccgggccctgggcgccgccgtggaggccttgctg
gccgcgctgggcgccgccaaccgcgggccccgggccgagccccccgccgccaccgcctca
gccgcctccgccaccggggtcttccccgccaaggtgctggggctccgcgtttgcggcctc
taccgcgagtggctgagccgcaccgagggcgacctgggccagctgctgcccgggggctcg
gcctga

DBGET integrated database retrieval system