KEGG   Homo sapiens (human): 149233Help
Entry
149233            CDS       T01001                                 

Gene name
IL23R
Definition
(RefSeq) interleukin 23 receptor
  KO
K05065  
interleukin 23 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Th17 cell differentiation
Pathways in cancer
Inflammatory bowel disease (IBD)
Network
N00053  
Cytokine-Jak-STAT signaling pathway
Disease
H00286  
Crohn's disease
H01227  
Inflammatory bowel disease (IBD)
H01466  
Ulcerative colitis (UC)
H01476  
Behcet Disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    149233 (IL23R)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    149233 (IL23R)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    149233 (IL23R)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    149233 (IL23R)
  Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    149233 (IL23R)
Cytokine receptors [BR:hsa04050]
 Class I cytokine receptor (hematopoietin family receptor)
  149233 (IL23R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q5VWK5(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1p31.3
AA seq 629 aa AA seqDB search
MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDIS
SGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII
YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
KRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGM
IVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN
NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDL
NTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSL
SNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGI
VNEELPSINTYFPQNILESHFNRISLLEK
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggtcactattcaatgggatgcagtaatagccctttacatactcttcagctgg
tgtcatggaggaattacaaatataaactgctctggccacatctgggtagaaccagccaca
atttttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaaggaaacttcatttttataaaaatggcatcaaagaaagatttcaaatcacaaggatt
aataaaacaacagctcggctttggtataaaaactttctggaaccacatgcttctatgtac
tgcactgctgaatgtcccaaacattttcaagagacactgatatgtggaaaagacatttct
tctggatatccgccagatattcctgatgaagtaacctgtgtcatttatgaatattcaggc
aacatgacttgcacctggaatgctgggaagctcacctacatagacacaaaatacgtggta
catgtgaagagtttagagacagaagaagagcaacagtatctcacctcaagctatattaac
atctccactgattcattacaaggtggcaagaagtacttggtttgggtccaagcagcaaac
gcactaggcatggaagagtcaaaacaactgcaaattcacctggatgatatagtgatacct
tctgcagccgtcatttccagggctgagactataaatgctacagtgcccaagaccataatt
tattgggatagtcaaacaacaattgaaaaggtttcctgtgaaatgagatacaaggctaca
acaaaccaaacttggaatgttaaagaatttgacaccaattttacatatgtgcaacagtca
gaattctacttggagccaaacattaagtacgtatttcaagtgagatgtcaagaaacaggc
aaaaggtactggcagccttggagttcactgttttttcataaaacacctgaaacagttccc
caggtcacatcaaaagcattccaacatgacacatggaattctgggctaacagttgcttcc
atctctacagggcaccttacttctgacaacagaggagacattggacttttattgggaatg
atcgtctttgctgttatgttgtcaattctttctttgattgggatatttaacagatcattc
cgaactgggattaaaagaaggatcttattgttaataccaaagtggctttatgaagatatt
cctaatatgaaaaacagcaatgttgtgaaaatgctacaggaaaatagtgaacttatgaat
aataattccagtgagcaggtcctatatgttgatcccatgattacagagataaaagaaatc
ttcatcccagaacacaagcctacagactacaagaaggagaatacaggacccctggagaca
agagactacccgcaaaactcgctattcgacaatactacagttgtatatattcctgatctc
aacactggatataaaccccaaatttcaaattttctgcctgagggaagccatctcagcaat
aataatgaaattacttccttaacacttaaaccaccagttgattccttagactcaggaaat
aatcccaggttacaaaagcatcctaattttgctttttctgtttcaagtgtgaattcacta
agcaacacaatatttcttggagaattaagcctcatattaaatcaaggagaatgcagttct
cctgacatacaaaactcagtagaggaggaaaccaccatgcttttggaaaatgattcaccc
agtgaaactattccagaacagaccctgcttcctgatgaatttgtctcctgtttggggatc
gtgaatgaggagttgccatctattaatacttattttccacaaaatattttggaaagccac
ttcaataggatttcactcttggaaaagtag

DBGET integrated database retrieval system