KEGG   Homo sapiens (human): 149233Help
Entry
149233            CDS       T01001                                 

Gene name
IL23R
Definition
interleukin 23 receptor
Orthology
K05065  
interleukin 23 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Inflammatory bowel disease (IBD)
Disease
H00286  
Crohn's disease
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:hsa05321]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.3
AA seq 629 aa AA seqDB search
MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRKLHFYKNGIKERFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDIS
SGYPPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAAVISRAETINATVPKTII
YWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTNFTYVQQSEFYLEPNIKYVFQVRCQETG
KRYWQPWSSLFFHKTPETVPQVTSKAFQHDTWNSGLTVASISTGHLTSDNRGDIGLLLGM
IVFAVMLSILSLIGIFNRSFRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENSELMN
NNSSEQVLYVDPMITEIKEIFIPEHKPTDYKKENTGPLETRDYPQNSLFDNTTVVYIPDL
NTGYKPQISNFLPEGSHLSNNNEITSLTLKPPVDSLDSGNNPRLQKHPNFAFSVSSVNSL
SNTIFLGELSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGI
VNEELPSINTYFPQNILESHFNRISLLEK
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggtcactattcaatgggatgcagtaatagccctttacatactcttcagctgg
tgtcatggaggaattacaaatataaactgctctggccacatctgggtagaaccagccaca
atttttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaaggaaacttcatttttataaaaatggcatcaaagaaagatttcaaatcacaaggatt
aataaaacaacagctcggctttggtataaaaactttctggaaccacatgcttctatgtac
tgcactgctgaatgtcccaaacattttcaagagacactgatatgtggaaaagacatttct
tctggatatccgccagatattcctgatgaagtaacctgtgtcatttatgaatattcaggc
aacatgacttgcacctggaatgctgggaagctcacctacatagacacaaaatacgtggta
catgtgaagagtttagagacagaagaagagcaacagtatctcacctcaagctatattaac
atctccactgattcattacaaggtggcaagaagtacttggtttgggtccaagcagcaaac
gcactaggcatggaagagtcaaaacaactgcaaattcacctggatgatatagtgatacct
tctgcagccgtcatttccagggctgagactataaatgctacagtgcccaagaccataatt
tattgggatagtcaaacaacaattgaaaaggtttcctgtgaaatgagatacaaggctaca
acaaaccaaacttggaatgttaaagaatttgacaccaattttacatatgtgcaacagtca
gaattctacttggagccaaacattaagtacgtatttcaagtgagatgtcaagaaacaggc
aaaaggtactggcagccttggagttcactgttttttcataaaacacctgaaacagttccc
caggtcacatcaaaagcattccaacatgacacatggaattctgggctaacagttgcttcc
atctctacagggcaccttacttctgacaacagaggagacattggacttttattgggaatg
atcgtctttgctgttatgttgtcaattctttctttgattgggatatttaacagatcattc
cgaactgggattaaaagaaggatcttattgttaataccaaagtggctttatgaagatatt
cctaatatgaaaaacagcaatgttgtgaaaatgctacaggaaaatagtgaacttatgaat
aataattccagtgagcaggtcctatatgttgatcccatgattacagagataaaagaaatc
ttcatcccagaacacaagcctacagactacaagaaggagaatacaggacccctggagaca
agagactacccgcaaaactcgctattcgacaatactacagttgtatatattcctgatctc
aacactggatataaaccccaaatttcaaattttctgcctgagggaagccatctcagcaat
aataatgaaattacttccttaacacttaaaccaccagttgattccttagactcaggaaat
aatcccaggttacaaaagcatcctaattttgctttttctgtttcaagtgtgaattcacta
agcaacacaatatttcttggagaattaagcctcatattaaatcaaggagaatgcagttct
cctgacatacaaaactcagtagaggaggaaaccaccatgcttttggaaaatgattcaccc
agtgaaactattccagaacagaccctgcttcctgatgaatttgtctcctgtttggggatc
gtgaatgaggagttgccatctattaatacttattttccacaaaatattttggaaagccac
ttcaataggatttcactcttggaaaagtag

DBGET integrated database retrieval system