KEGG   Homo sapiens (human): 149461Help
Entry
149461            CDS       T01001                                 

Gene name
CLDN19, HOMG5
Definition
claudin 19
Orthology
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Disease
H01210  
Hypomagnesemia
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34.2
AA seq 211 aa AA seqDB search
MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTG
QVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAI
AGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGS
FLCCTCPEPERPNSSPQPYRPGPSAAAREYV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccaactcaggcctccagctcctgggctacttcttggccctgggtggctgggtgggc
atcattgctagcacagccctgccacagtggaagcagtcttcctacgcaggcgacgccatc
atcactgccgtgggcctctatgaagggctctggatgtcctgcgcctcccagagcactggg
caagtgcagtgcaagctctacgactcgctgctcgccctggacggtcacatccaatcagcg
cgggccctgatggtggtggccgtgctcctgggcttcgtggccatggtcctcagcgtagtt
ggcatgaagtgtacgcgggtgggagacagcaaccccattgccaagggccgtgttgccatc
gccgggggagccctcttcatcctggcaggcctctgcactttgactgctgtctcgtggtat
gccaccctggtgacccaggagttcttcaacccaagcacacctgtcaatgccaggtatgaa
tttggcccagccctgttcgtgggctgggcctcagctggcctggccgtgctgggcggctcc
ttcctctgctgcacatgcccggagccagagagacccaacagcagcccacagccctatcgg
cctggaccctctgctgctgcccgagagtacgtctga

DBGET integrated database retrieval system