KEGG   Homo sapiens (human): 1500Help
Entry
1500              CDS       T01001                                 

Gene name
CTNND1, CAS, CTNND, P120CAS, P120CTN, p120, p120(CAS), p120(CTN)
Definition
(RefSeq) catenin delta 1
  KO
K05690  
catenin (cadherin-associated protein), delta 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Adherens junction
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    1500 (CTNND1)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    1500 (CTNND1)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    1500 (CTNND1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O60716(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q12.1
AA seq 968 aa AA seqDB search
MDDSEVESTASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTL
TRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGA
MSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGR
DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEER
YRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDLDYGMMS
DYGTARRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP
PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHP
KKEVHLGACGALKNISFGRDQDNKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLS
SHDSIKMEIVDHALHALTDEVIIPHSGWEREPNEDCKPRHIEWESVLTNTAGCLRNVSSE
RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERY
QEAAPNVANNTGPHAASCFGAKKGKDEWFSRGKKPIEDPANDTVDFPKRTSPARGYELLF
QPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLT
NEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILN
TINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLE
KEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSL
DNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQV
SYPSMQKI
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggacgactcagaggtggagtcgaccgccagcatcttggcctctgtgaaggaacaagag
gcccagtttgagaagctgacccgggcgctggaggaggaacggcgccacgtctcggcgcag
ctggaacgcgtccgggtctcaccacaagatgccaacccactcatggccaacggcacactc
acccgccggcatcagaacggccggtttgtgggcgatgctgaccttgaaagacagaaattt
tcagatttgaaactcaacggaccccaggatcacagtcaccttctatatagcaccatcccc
aggatgcaggagccggggcagattgtggagacctacacggaggaggatcctgagggagcc
atgtctgtagtctctgtggagacctcagatgatgggaccactcggcgcacagagaccacg
gtcaagaaagtagtgaagactgtgacaacacggacagtacagccagtcgctatgggacca
gacgggttgcctgtggatgcttcatcagtttctaacaactatatccagactttgggtcgt
gatttccgcaagaatggcaatgggggacctggtccctatgtggggcaagctggcactgct
acccttcctaggaacttccactaccctcctgatggttatagtcgccactatgaagatggt
tatccaggtggcagtgataactatggcagtctgtcccgggtgacccgcattgaggagcgg
tataggcccagcatggaaggctaccgggcacctagtagacaggatgtgtatgggccccaa
ccccaggttcgggtaggtgggagcagcgtggatctgcatcgctttcatccagagccttat
gggctagaggatgaccagcgtagtatgggctatgatgacctggattatggtatgatgtct
gattatggcactgcccgtcggactgggacaccctctgaccctcgtcggcgcctcaggagc
tatgaagacatgattggtgaggaggtgccatcggatcaatactactgggctcctttggcc
cagcatgagcgaggaagtttagcaagcttggatagcctgcgcaaaggagggcctccacct
cctaattggagacagccagagctgccagaggtgatcgccatgcttggattccgcttggat
gctgtcaagtccaatgcagctgcatacctgcaacacttatgctaccgcaatgacaaggtg
aagactgacgtgcggaagctcaagggcatcccagtactggtgggattgttagaccatccc
aaaaaggaagtgcaccttggagcctgtggagctctcaagaatatctcttttggacgtgac
caggataacaagattgccataaaaaactgtgatggtgtgcctgcccttgtgcgattgctt
cgaaaggctcgtgatatggaccttactgaagttattaccggaaccctgtggaatctttca
tcccatgactcaatcaaaatggagattgtggaccatgcactgcatgccttgacagatgaa
gtgatcattcctcattctggttgggagcgggaacctaatgaagactgtaagccacgccat
attgagtgggaatcggtgctcaccaacacagctggctgccttaggaatgtaagctcagag
aggagtgaagctcgccggaaacttcgggaatgtgatggtttagttgatgccctcattttc
attgttcaggctgagattgggcagaaggattcagacagcaagcttgtagagaactgtgtt
tgccttcttcggaacttatcatatcaagttcaccgggagatcccacaggcagagcgttac
caagaggcagctcccaatgttgccaacaatactgggccacatgctgccagttgctttggg
gccaagaagggcaaagatgagtggttctccagagggaaaaaacctatagaggatccagca
aacgatacagtggatttccctaaaagaacgagtccagctcgaggctatgagctcttattt
cagccagaggtggttcggatatacatctcacttcttaaggagagcaagactcctgccatc
ctagaagcctcagctggagctatccagaacttgtgtgctgggcgctggacgtatggtcga
tacatccgctctgctctgcgtcaagagaaggctctttctgccatagctgacctcctgact
aatgaacatgaacgggtggtgaaagctgcatctggagcactgagaaacctggctgtggat
gctcgcaacaaagaattaattggtaaacatgctattcctaacttggtaaagaatctgcca
ggaggacagcagaactcctcttggaatttctctgaggacactgtcatctctattttgaac
actatcaacgaggttatcgctgagaacttggaggctgccaaaaagcttcgagagacacag
ggtattgagaagctggtgttgatcaacaaatcagggaaccgctcagaaaaagaagttcga
gcagcagcacttgtattacagacaatctggggatataaggaactgcggaagccactggaa
aaagaaggatggaagaaatcagactttcaggtgaatctaaacaatgcttcccgaagccag
agcagtcattcatatgatgatagtactctccctctcattgaccggaaccaaaaatcagat
aagaaacctgatcgggaagaaattcagatgagcaatatgggatcaaacacaaaatcacta
gataacaactattccacaccaaatgagagaggagaccacaatagaacactggatcgatcg
ggggatctaggcgacatggagccattgaagggaacaacacccttgatgcaggacgagggg
caggaatctctggaggaagagttggatgtgttggttttggatgatgaggggggccaagtg
tcttacccctccatgcagaagatttag

DBGET integrated database retrieval system