KEGG   Homo sapiens (human): 150084Help
Entry
150084            CDS       T01001                                 

Gene name
IGSF5, GSF5, JAM4
Definition
immunoglobulin superfamily, member 5
Orthology
K06786  
junctional adhesion molecule 4
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell communication
   04530 Tight junction
    150084 (IGSF5)
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    150084 (IGSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.2
AA seq 407 aa AA seqDB search
MGQKERSTADTLPDLEEWKSAAGLRWWQTAVVDGSGSGNEVIEGPQNARVLKGSQARFNC
TVSQGWKLIMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGN
IRCSLQNSRLHGSAYLTVQVMGELFIPSVNLVVAENEPCEVTCLPSHWTRLPDISWELGL
LVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCVATWKSLKARKSATVNLTVIRCPQD
TGGGINIPGVLSSLPSLGFSLPTWGKVGLGLAGTMLLTPTCTLTIRCCCCRRRCCGCNCC
CRCCFCCRRKRGFRIQFQKKSEKEKTNKETETESGNENSGYNSDEQKTTDTASLPPKSCE
SSDPEQRNSSCGPPHQRADQRPPRPASHPQASFNLASPEKVSNTTVV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagaaggaaaggagcacagcagatactctgccggatctggaggaatggaagtca
gcggcgggtctgcgatggtggcaaacagcagtggtggacggttctgggtctggtaatgaa
gtcatagaaggcccccaaaatgcaagagtcctgaagggctcccaggctcgcttcaactgc
accgtctcccagggctggaagctcatcatgtgggctctcagtgacatggtggtgctaagc
gtcaggcccatggagcccatcatcaccaatgaccgcttcacctctcagaggtacgaccag
ggcgggaacttcacctcggagatgatcatccacaatgtggagcccagtgattcggggaac
atcagatgcagcctccagaacagtcgcctgcatggatctgcttaccttaccgtccaagtt
atgggagagctgttcattcccagtgttaatcttgtagtcgctgagaatgaaccttgtgaa
gttacttgtctaccctcacactggacccggctcccggatatttcctgggagctcggtctc
ctggtcagccattcaagctattattttgttccggagcccagcgaccttcaaagtgcagtg
agcatcctggctctgaccccacagagcaatgggactttgacttgcgtggctacctggaag
agcctgaaggcccgcaagtctgcaactgtaaatctcactgtgattcggtgtccccaagac
actggaggtggtattaatattccaggtgtattatcaagtttaccgagtttaggtttttca
ttgcctacttggggcaaagttggacttggactagcaggcaccatgcttctgacgccgacg
tgtactcttacaatacgctgctgctgctgccgccgtcgttgttgtggctgcaactgctgc
tgccgttgttgtttctgctgtagaagaaaaagaggatttcgtattcaatttcaaaagaaa
tctgaaaaagagaagacaaacaaagaaactgagacagaaagtggaaatgaaaactccggc
tacaattcagatgaacaaaagaccacagacaccgcttctctccctcccaaatcctgtgaa
tccagtgatcctgaacaaagaaacagtagctgtggccctcctcaccagcgggctgatcaa
cgtccacccaggccagcaagtcatccacaggcttcttttaatctggccagtcctgagaag
gtcagtaatacaactgtagtatag

DBGET integrated database retrieval system