KEGG   Homo sapiens (human): 150084Help
Entry
150084            CDS       T01001                                 

Gene name
IGSF5, GSF5, JAM4
Definition
(RefSeq) immunoglobulin superfamily member 5
  KO
K06786  junctional adhesion molecule 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    150084 (IGSF5)
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    150084 (IGSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 I-set ig V-set
Motif
Other DBs
NCBI-GeneID: 150084
NCBI-ProteinID: NP_001073913
OMIM: 610638
HGNC: 5952
Ensembl: ENSG00000183067
Vega: OTTHUMG00000086724
Pharos: Q9NSI5(Tbio)
UniProt: Q9NSI5
Position
21q22.2
AA seq 407 aa AA seqDB search
MGQKERSTADTLPDLEEWKSAAGLRWWQTAVVDGSGSGNEVIEGPQNARVLKGSQARFNC
TVSQGWKLIMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGN
IRCSLQNSRLHGSAYLTVQVMGELFIPSVNLVVAENEPCEVTCLPSHWTRLPDISWELGL
LVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCVATWKSLKARKSATVNLTVIRCPQD
TGGGINIPGVLSSLPSLGFSLPTWGKVGLGLAGTMLLTPTCTLTIRCCCCRRRCCGCNCC
CRCCFCCRRKRGFRIQFQKKSEKEKTNKETETESGNENSGYNSDEQKTTDTASLPPKSCE
SSDPEQRNSSCGPPHQRADQRPPRPASHPQASFNLASPEKVSNTTVV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagaaggaaaggagcacagcagatactctgccggatctggaggaatggaagtca
gcggcgggtctgcgatggtggcaaacagcagtggtggacggttctgggtctggtaatgaa
gtcatagaaggcccccaaaatgcaagagtcctgaagggctcccaggctcgcttcaactgc
accgtctcccagggctggaagctcatcatgtgggctctcagtgacatggtggtgctaagc
gtcaggcccatggagcccatcatcaccaatgaccgcttcacctctcagaggtacgaccag
ggcgggaacttcacctcggagatgatcatccacaatgtggagcccagtgattcggggaac
atcagatgcagcctccagaacagtcgcctgcatggatctgcttaccttaccgtccaagtt
atgggagagctgttcattcccagtgttaatcttgtagtcgctgagaatgaaccttgtgaa
gttacttgtctaccctcacactggacccggctcccggatatttcctgggagctcggtctc
ctggtcagccattcaagctattattttgttccggagcccagcgaccttcaaagtgcagtg
agcatcctggctctgaccccacagagcaatgggactttgacttgcgtggctacctggaag
agcctgaaggcccgcaagtctgcaactgtaaatctcactgtgattcggtgtccccaagac
actggaggtggtattaatattccaggtgtattatcaagtttaccgagtttaggtttttca
ttgcctacttggggcaaagttggacttggactagcaggcaccatgcttctgacgccgacg
tgtactcttacaatacgctgctgctgctgccgccgtcgttgttgtggctgcaactgctgc
tgccgttgttgtttctgctgtagaagaaaaagaggatttcgtattcaatttcaaaagaaa
tctgaaaaagagaagacaaacaaagaaactgagacagaaagtggaaatgaaaactccggc
tacaattcagatgaacaaaagaccacagacaccgcttctctccctcccaaatcctgtgaa
tccagtgatcctgaacaaagaaacagtagctgtggccctcctcaccagcgggctgatcaa
cgtccacccaggccagcaagtcatccacaggcttcttttaatctggccagtcctgagaag
gtcagtaatacaactgtagtatag

DBGET integrated database retrieval system