KEGG   Homo sapiens (human): 150084Help
Entry
150084            CDS       T01001                                 

Gene name
IGSF5, GSF5, JAM4
Definition
(RefSeq) immunoglobulin superfamily member 5
  KO
K06786  
junctional adhesion molecule 4
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    150084 (IGSF5)
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    150084 (IGSF5)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Others
   JAM4, JCAM; junctional adhesion molecule 4 [KO:K06786]
    150084 (IGSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.2
AA seq 407 aa AA seqDB search
MGQKERSTADTLPDLEEWKSAAGLRWWQTAVVDGSGSGNEVIEGPQNARVLKGSQARFNC
TVSQGWKLIMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGN
IRCSLQNSRLHGSAYLTVQVMGELFIPSVNLVVAENEPCEVTCLPSHWTRLPDISWELGL
LVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCVATWKSLKARKSATVNLTVIRCPQD
TGGGINIPGVLSSLPSLGFSLPTWGKVGLGLAGTMLLTPTCTLTIRCCCCRRRCCGCNCC
CRCCFCCRRKRGFRIQFQKKSEKEKTNKETETESGNENSGYNSDEQKTTDTASLPPKSCE
SSDPEQRNSSCGPPHQRADQRPPRPASHPQASFNLASPEKVSNTTVV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagaaggaaaggagcacagcagatactctgccggatctggaggaatggaagtca
gcggcgggtctgcgatggtggcaaacagcagtggtggacggttctgggtctggtaatgaa
gtcatagaaggcccccaaaatgcaagagtcctgaagggctcccaggctcgcttcaactgc
accgtctcccagggctggaagctcatcatgtgggctctcagtgacatggtggtgctaagc
gtcaggcccatggagcccatcatcaccaatgaccgcttcacctctcagaggtacgaccag
ggcgggaacttcacctcggagatgatcatccacaatgtggagcccagtgattcggggaac
atcagatgcagcctccagaacagtcgcctgcatggatctgcttaccttaccgtccaagtt
atgggagagctgttcattcccagtgttaatcttgtagtcgctgagaatgaaccttgtgaa
gttacttgtctaccctcacactggacccggctcccggatatttcctgggagctcggtctc
ctggtcagccattcaagctattattttgttccggagcccagcgaccttcaaagtgcagtg
agcatcctggctctgaccccacagagcaatgggactttgacttgcgtggctacctggaag
agcctgaaggcccgcaagtctgcaactgtaaatctcactgtgattcggtgtccccaagac
actggaggtggtattaatattccaggtgtattatcaagtttaccgagtttaggtttttca
ttgcctacttggggcaaagttggacttggactagcaggcaccatgcttctgacgccgacg
tgtactcttacaatacgctgctgctgctgccgccgtcgttgttgtggctgcaactgctgc
tgccgttgttgtttctgctgtagaagaaaaagaggatttcgtattcaatttcaaaagaaa
tctgaaaaagagaagacaaacaaagaaactgagacagaaagtggaaatgaaaactccggc
tacaattcagatgaacaaaagaccacagacaccgcttctctccctcccaaatcctgtgaa
tccagtgatcctgaacaaagaaacagtagctgtggccctcctcaccagcgggctgatcaa
cgtccacccaggccagcaagtcatccacaggcttcttttaatctggccagtcctgagaag
gtcagtaatacaactgtagtatag

DBGET integrated database retrieval system