KEGG   Homo sapiens (human): 150094Help
Entry
150094            CDS       T01001                                 

Gene name
SIK1, EIEE30, MSK, SIK, SNF1LK
Definition
(RefSeq) salt inducible kinase 1
  KO
K19008  
serine/threonine-protein kinase SIK1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    150094 (SIK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     150094 (SIK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   150094 (SIK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 783 aa AA seqDB search
MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDK
TRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGH
LSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKSGEPL
STWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGR
FRIPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRAEPCLPGPACPAFSAHSYTSN
LGDYDEQALGIMQTLGVDRQRTVESLQNSSYNHFAAIYYLLLERLKEYRNAQCARPGPAR
QPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFP
VDASCSGVFRPRPVSPSSLLDTAISEEARQGPGLEEEQDTQESLPSSTGRRHTLAEVSTR
LSPLTAPCIVVSPSTTASPAEGTSSDSCLTFSASKSPAGLSGTPATQGLLGACSPVRLAS
PFLGSQSATPVLQAQGGLGGAVLLPVSFQEGRRASDTSLTQGLKAFRQQLRKTTRTKGFL
GLNKIKGLARQVCQAPASRASRGGLSPFHAPAQSPGLHGGAAGSREGWSLLEEVLEQQRL
LQLQHHPAAAPGCSQAPQPAPAPFVIAPCDGPGAAPLPSTLLTSGLPLLPPPLLQTGASP
VASAAQLLDTHLHIGTGPTALPAVPPPRLARLAPGCEPLGLLQGDCEMEDLMPCSLGTFV
LVQ
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggttatcatgtcggagttcagcgcggaccccgcgggccagggtcagggccagcagaag
cccctccgggtgggtttttacgacatcgagcggaccctgggcaaaggcaacttcgcggtg
gtgaagctggcgcggcatcgagtcaccaaaacgcaggttgcaataaaaataattgataaa
acacgattagattcaagcaatttggagaaaatctatcgtgaggttcagctgatgaagctt
ctgaaccatccacacatcataaagctttaccaggttatggaaacaaaggacatgctttac
atcgtcactgaatttgctaaaaatggagaaatgtttgattatttgacttccaacgggcac
ctgagtgagaacgaggcgcggaagaagttctggcaaatcctgtcggccgtggagtactgt
cacgaccatcacatcgtccaccgggacctcaagaccgagaacctcctgctggatggcaac
atggacatcaagctggcagattttggatttgggaatttctacaagtcaggagagcctctg
tccacgtggtgtgggagccccccgtatgccgccccggaagtctttgaggggaaggagtat
gaaggcccccagctggacatctggagcctgggcgtggtgctgtacgtcctggtctgcggt
tctctccccttcgatgggcctaacctgccgacgctgagacagcgggtgctggagggccgc
ttccgcatccccttcttcatgtctcaagactgtgagagcctgatccgccgcatgctggtg
gtggaccccgccaggcgcatcaccatcgcccagatccggcagcaccggtggatgcgggct
gagccctgcttgccgggacccgcctgccccgccttctccgcacacagctacacctccaac
ctgggcgactacgatgagcaggcgctgggtatcatgcagaccctgggcgtggaccggcag
aggacggtggagtcactgcaaaacagcagctataaccactttgctgccatttattacctc
ctccttgagcggctcaaggagtatcggaatgcccagtgcgcccgccccgggcctgccagg
cagccgcggcctcggagctcggacctcagtggtttggaggtgcctcaggaaggtctttcc
accgaccctttccgacctgccttgctgtgcccgcagccgcagaccttggtgcagtccgtc
ctccaggccgagatggactgtgagctccagagctcgctgcagtggcccttgttcttcccg
gtggatgccagctgcagcggagtgttccggccccggcccgtgtccccaagcagcctgctg
gacacagccatcagtgaggaggccaggcaggggccgggcctagaggaggagcaggacacg
caggagtccctgcccagcagcacgggccggaggcacaccctggccgaggtctccacccgc
ctctccccactcaccgcgccatgtatagtcgtctccccctccaccacggcaagtcctgca
gagggaaccagctctgacagttgtctgaccttctctgcgagcaaaagccccgcggggctc
agtggcaccccggccactcaggggctgctgggcgcctgctccccggtcaggctggcctcg
cccttcctggggtcgcagtccgccaccccagtgctgcaggctcaggggggcttgggagga
gctgttctgctccctgtcagcttccaggagggacggcgggcgtcggacacctcactgact
caagggctgaaggcctttcggcagcagctgaggaagaccacgcggaccaaagggtttctg
ggactgaacaaaatcaaggggctggctcgccaggtgtgccaggcccccgccagccgggcc
agcaggggcggcctgagccccttccacgcccctgcacagagcccaggcctgcacggcggc
gcagccggcagccgggagggctggagcctgctggaggaggtgctagagcagcagaggctg
ctccagttacagcaccacccggccgctgcacccggctgctcccaggccccccagccggcc
cctgccccgtttgtgatcgccccctgtgatggccctggggctgccccgctccccagcacc
ctcctcacgtcggggctcccgctgctgccgcccccactcctgcagaccggcgcgtccccg
gtggcctcagcggcgcagctcctggacacacacctgcacattggcaccggccccaccgcc
ctccccgctgtgcccccaccacgcctggccaggctggccccaggttgtgagcccctgggg
ctgctgcagggggactgtgagatggaggacctgatgccctgctccctaggcacgtttgtc
ctggtgcagtga

DBGET integrated database retrieval system