KEGG   Homo sapiens (human): 1503Help
Entry
1503              CDS       T01001                                 

Gene name
CTPS1, CTPS, IMD24
Definition
CTP synthase 1 (EC:6.3.4.2)
Orthology
K01937  
CTP synthase [EC:6.3.4.2]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    1503 (CTPS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     1503 (CTPS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34.1
AA seq 435 aa AA seqDB search
MPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVC
RCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIER
QPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKY
IDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFL
GVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTL
FQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELED
HPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSP
DSEITELKFPSINHD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgccctttattgaggccttccgtcagttccaattcaaggtcaaaagagagaacttttgt
aacatccacgtcagtctagttccccagccaagttcaacaggggaacagaagactaaacct
acccagaatagtgttcgggaacttagaggacttgggctttccccagatctggttgtatgc
aggtgctcaaatccacttgacacatcagtgaaggagaaaatatcaatgttctgccatgtt
gagcctgaacaagtgatctgtgtccacgatgtctcatccatctaccgagtccccttgttg
ttagaggagcaaggggttgtagattattttcttcgaagacttgaccttcctattgagagg
cagccaagaaaaatgctgatgaaatggaaagagatggctgacagatatgatcgcttgctg
gagacctgctctattgcccttgtgggcaaatacacgaagttctcagactcctatgcctct
gtcattaaggctctggagcattctgcactggccatcaaccacaaattggaaatcaagtac
atagattctgcggacttggagcccatcacctcgcaagaagagcccgtgcgctaccacgaa
gcttggcagaagctctgtagtgctcatggagtgctggttccaggaggatttggtgttcga
ggaacagaaggaaaaatccaagcaattgcctgggctcggaatcagaaaaagccttttttg
ggcgtgtgcttagggatgcagttggcagtggttgaattctcaagaaacgtgctgggatgg
caagatgccaattctacagagtttgaccctacgaccagtcatcccgtggtcgtagacatg
ccagaacacaacccagggcagatgggcggaaccatgaggctgggcaagaggagaaccctg
ttccagaccaagaactcagtcatgaggaaactctatggagacgcagactacttggaagag
aggcaccgccaccgatttgaggtgaatccagtctggaaaaagtgtttggaagaacaaggc
ttgaagtttgttggccaagatgttgaaggagagagaatggaaattgtggagttagaagat
catcccttttttgttggggttcagtaccaccctgagttcctgtccaggcctatcaagccc
tccccaccatactttggcctcctcctggcctctgtggggcggctctcacattacctccag
aaaggctgcaggctctcacccagggacacctatagtgacaggagtggaagcagctcccct
gactctgaaatcaccgaactgaagtttccatcaataaatcatgactga

DBGET integrated database retrieval system