KEGG   Homo sapiens (human): 150681Help
Entry
150681            CDS       T01001                                 

Gene name
OR6B3, OR6B3P, OR6B3Q
Definition
(RefSeq) olfactory receptor family 6 subfamily B member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    150681 (OR6B3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    150681 (OR6B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 150681
NCBI-ProteinID: NP_775486
HGNC: 15042
Ensembl: ENSG00000178586
Vega: OTTHUMG00000152399
Pharos: Q8NGW1(Tdark)
UniProt: Q8NGW1
Position
2q37.3
AA seq 331 aa AA seqDB search
MSGENVTRVGTFILVGFPTAPGLQYLLFLLFLLTYLFVLVENLAIILTVWSSTSLHRPMY
YFLSSMSFLEIWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFFSSLVCTECVLLASMAY
DRYVAICHPLRYHVLVTPGLCLQLVGFSFVSGFTISMIKVCFISSVTFCGSNVLNHFFCD
ISPILKLACTDFSTAELVDFILAFIILVFPLLATMLSYAHITLAVLRIPSATGCWRAFFT
CASHLTVVTVFYTALLFMYVRPQAIDSRSSNKLISVLYTVITPILNPLIYCLRNKEFKNA
LKKAFGLTSCAVEGRLSSLLELHLQIHSQPL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagtggggagaatgtcaccagggtcggcaccttcatcctggtgggcttccccacggcc
ccagggctgcagtacctgctcttcctcctcttcctgctcacctacctctttgtcctggtg
gagaacctggccatcatcctcaccgtctggagcagcacctccctccacaggcccatgtac
tactttctgagctccatgtctttcctagagatctggtacgtgtctgacatcacccccaag
atgctggagggcttcctcctccagcagaaacgcatctctttcgtcgggtgcatgacgcag
ctctacttcttcagctccctggtgtgcaccgagtgtgtgcttctggcctccatggcctac
gaccgctacgtggccatctgccacccgctgcgctaccacgtccttgtgaccccggggctg
tgcctccagctggtgggcttctcctttgtgagtggcttcaccatctccatgatcaaggtc
tgttttatctccagcgtcacgttctgtggctccaacgtcttgaaccacttcttctgtgac
atttcccccatcctcaagctggcctgcacggacttctccactgcagagctggtggatttc
attctggccttcatcatcctggtgtttccactcctggccaccatgctgtcatatgcgcac
atcaccctggctgtcctgcgcatcccctcggccaccggctgctggagagccttcttcacc
tgcgcctctcacctcaccgtggtcaccgtcttctatacagccttgcttttcatgtatgtc
cggccccaggccattgattcccggagctccaacaagctcatctctgttttgtacacagtt
atcacccccatcttgaaccccttgatatactgcctgaggaataaggaatttaagaatgcc
ttgaaaaaagccttcggcttgacgagctgcgccgtagaggggaggctttctagtcttctg
gaacttcatctccaaatacacagccagcctctctga

DBGET integrated database retrieval system