KEGG   Homo sapiens (human): 150962Help
Entry
150962            CDS       T01001                                 

Gene name
PUS10, CCDC139, DOBI
Definition
(RefSeq) pseudouridylate synthase 10
  KO
K07583  
tRNA pseudouridine synthase 10 [EC:5.4.99.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.-  
     150962 (PUS10)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    150962 (PUS10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p16.1
AA seq 529 aa AA seqDB search
MFPLTEENKHVAQLLLNTGTCPRCIFRFCGVDFHAPYKLPYKELLNELQKFLETEKDELI
LEVMNPPPKKIRLQELEDSIDNLSQNGEGRISVSHVGSTASKNSNLNVCNVCLGILQEFC
EKDFIKKVCQKVEASGFEFTSLVFSVSFPPQLSVREHAAWLLVKQEMGKQSLSLGRDDIV
QLKEAYKWITHPLFSEELGVPIDGKSLFEVSVVFAHPETVEDCHFLAAICPDCFKPAKNK
QSVFTRMAVMKALNKIKEEDFLKQFPCPPNSPKAVCAVLEIECAHGAVFVAGRYNKYSRN
LPQTPWIIDGERKLESSVEELISDHLLAVFKAESFNFSSSGREDVDVRTLGNGRPFAIEL
VNPHRVHFTSQEIKELQQKINNSSNKIQVRDLQLVTREAIGHMKEGEEEKTKTYSALIWT
NKAIQKKDIEFLNDIKDLKIDQKTPLRVLHRRPLAVRARVIHFMETQYVDEHHFRLHLKT
QAGTYIKEFVHGDFGRTKPNIGSLMNVTADILELDVESVDVDWPPALDD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttcccactgactgaggaaaacaagcatgtggcccagttgttgctcaatactggtact
tgtccaagatgtatcttcagattctgtggtgtggattttcatgcaccttacaaacttcca
tacaaggagttgctcaatgaactacagaaatttctggaaactgaaaaagatgaattaatt
ttggaagttatgaacccacctcccaagaaaattcgactgcaagaactggaagatagtatt
gataatctaagtcaaaatggagagggaaggatctctgttagtcatgttggaagcactgct
tccaagaactcaaatttaaatgtatgtaatgtatgcctaggaattcttcaagaattctgt
gagaaagatttcattaaaaaggtgtgccaaaaggttgaggcctctgggtttgaattcacc
agcttggtattttcagtctccttcccaccacaactatctgtaagagagcatgctgcatgg
ttgctggtaaaacaggaaatgggaaagcagagtctgtcgctgggaagagatgatatagtt
cagctaaaagaagcctacaaatggataactcaccccctgttttcagaggaactgggtgtt
cccattgatggaaagagcttgtttgaagtgagtgtggtctttgctcacccagaaacagtt
gaggattgccacttcctagctgcgatatgcccagattgttttaagccagccaaaaacaaa
cagtctgtattcactagaatggcagttatgaaagccttgaataagataaaggaagaggat
ttccttaagcagtttccttgtcctccaaactcaccaaaggctgtatgcgctgttcttgaa
attgaatgtgctcatggtgctgtttttgtggctgggagatataataaatactccaggaat
ctaccacaaactccttggataattgatggagaaaggaagctggaatcttcagtggaagaa
ttaatttcagatcatctgttggcagtatttaaagcagagagttttaatttttcatcctct
ggaagagaagatgtagatgtgagaacattaggaaatggaaggccctttgcaattgagctg
gtgaatcctcatagagtacatttcacttcacaagaaattaaggaacttcagcagaaaatt
aataactcatctaacaaaatccaagtacgtgacttgcagcttgtcacaagagaggcaata
ggacatatgaaagaaggtgaagaagaaaagacaaagacctacagtgccttaatttggaca
aataaagcgatacagaagaaagacattgaattcctaaatgacataaaggacttaaaaatc
gaccagaaaacacctttgcgcgtccttcaccgaaggcccctggctgtgcgagctcgcgtc
attcacttcatggagacacagtacgtggatgagcaccacttccgcctccacttgaaaact
caggctggcacctacattaaagagtttgtacatggagacttcgggagaaccaagccaaac
attgggtccctgatgaatgtgactgcagacattctggagctggatgttgagtctgtagat
gttgactggccacctgctctggatgactag

DBGET integrated database retrieval system