KEGG   Homo sapiens (human): 151Help
Entry
151               CDS       T01001                                 

Gene name
ADRA2B, ADRA2L1, ADRA2RL1, ADRARL1, ALPHA2BAR, alpha-2BAR
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Epinephrine: 
Norepinephrine: 
Oxedrine: 
Metaraminol: 
Ephedrine: 
Methyldopa (levorotatory): 
Clonidine: 
Guanfacine: 
Rilmenidine: 
Phentolamine: 
Tolazoline: 
Phenoxybenzamine: 
Brimonidine: 
Methylergometrine: 
Ergometrine: 
Yohimbin: 
Tizanidine: 
Piribedil: 
Chlorpromazine: 
Levomepromazine: 
Asenapine: 
Dexmedetomidine: 
Mianserin: 
Mirtazapine: 
Lofexidine: 
Pseudoephedrine: 
Dipivefrine: 
Apraclonidine: 
Dapiprazole: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    151 (ADRA2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    151 (ADRA2B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    151 (ADRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q11.1
AA seq 450 aa AA seqDB search
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccaggacccctactccgtgcaggccacagcggccatagcggcggccatcacc
ttcctcattctctttaccatcttcggcaacgctctggtcatcctggctgtgttgaccagc
cgctcgctgcgcgcccctcagaacctgttcctggtgtcgctggccgccgccgacatcctg
gtggccacgctcatcatccctttctcgctggccaacgagctgctgggctactggtacttc
cggcgcacgtggtgcgaggtgtacctggcgctcgacgtgctcttctgcacctcgtccatc
gtgcacctgtgcgccatcagcctggaccgctactgggccgtgagccgcgcgctggagtac
aactccaagcgcaccccgcgccgcatcaagtgcatcatcctcactgtgtggctcatcgcc
gccgtcatctcgctgccgcccctcatctacaagggcgaccagggcccccagccgcgcggg
cgcccccagtgcaagctcaaccaggaggcctggtacatcctggcctccagcatcggatct
ttctttgctccttgcctcatcatgatccttgtctacctgcgcatctacctgatcgccaaa
cgcagcaaccgcagaggtcccagggccaagggggggcctgggcagggtgagtccaagcag
ccccgacccgaccatggtggggctttggcctcagccaaactgccagccctggcctctgtg
gcttctgccagagaggtcaacggacactcgaagtccactggggagaaggaggagggggag
acccctgaagatactgggacccgggccttgccacccagttgggctgcccttcccaactca
ggccagggccagaaggagggtgtttgtggggcatctccagaggatgaagctgaagaggag
gaagaggaggaggaggaggaggaagagtgtgaaccccaggcagtgccagtgtctccggcc
tcagcttgcagccccccgctgcagcagccacagggctcccgggtgctggccaccctacgt
ggccaggtgctcctgggcaggggcgtgggtgctataggtgggcagtggtggcgtcgacgg
gcgcagctgacccgggagaagcgcttcaccttcgtgctggctgtggtcattggcgttttt
gtgctctgctggttccccttcttcttcagctacagcctgggagccatctgcccgaagcac
tgcaaggtgccccatggcctcttccagttcttcttctggatcggctactgcaacagctca
ctgaaccctgttatctacaccatcttcaaccaggacttccgccgtgccttccggaggatc
ctgtgccgcccgtggacccagacggcctggtga

DBGET integrated database retrieval system