KEGG   Homo sapiens (human): 151Help
Entry
151               CDS       T01001                                 

Gene name
ADRA2B, ADRA2L1, ADRA2RL1, ADRARL1, ALPHA2BAR, FAME2, alpha-2BAR
Definition
(RefSeq) adrenoceptor alpha 2B
  KO
K04139  
adrenergic receptor alpha-2B
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Apraclonidine (DG01130): 
Arotinolol (DG01303): 
Brimonidine (DG00442): 
Chlorpromazine (DG00867): 
Clonidine (DG00249): 
Clozapine: 
Dapiprazole (DG01140): 
Dipivefrine (DG01129): 
Domazoline fumarate: 
Droxidopa: 
Ephedrine (DG00227): 
Epinephrine (DG00013): 
Epinephryl borate: 
Ergometrine (DG00446): 
Etilefrine (DG00210): 
Guanabenz (DG01230): 
Guanadrel: 
Guanadrel sulfate: 
Levomepromazine (DG00868): 
Metaraminol (DG00218): 
Methyldopa (levorotatory) (DG00248): 
Methylephedrine (DG01229): 
Methylergometrine (DG00445): 
Metizoline: 
Mianserin (DG00951): 
Mirtazapine: 
Norepinephrine (DG00212): 
Octodrine: 
Oxedrine (DG00217): 
Phenoxybenzamine (DG00285): 
Phentolamine (DG00280): 
Phenylpropanolamine (DG01041): 
Piribedil: 
Propylhexedrine (DG01919): 
Pseudoephedrine (DG01042): 
Racephedrine Hydrochloride: 
Setiptiline (DG01231): 
Sunepitron hydrochloride: 
Tizanidine (DG00773): 
Tolazoline (DG00281): 
Yohimbin (DG00485): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    151 (ADRA2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    151 (ADRA2B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    151 (ADRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P18089(Tclin)
UniProt: 
Position
2q11.2
AA seq 450 aa AA seqDB search
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccaggacccctactccgtgcaggccacagcggccatagcggcggccatcacc
ttcctcattctctttaccatcttcggcaacgctctggtcatcctggctgtgttgaccagc
cgctcgctgcgcgcccctcagaacctgttcctggtgtcgctggccgccgccgacatcctg
gtggccacgctcatcatccctttctcgctggccaacgagctgctgggctactggtacttc
cggcgcacgtggtgcgaggtgtacctggcgctcgacgtgctcttctgcacctcgtccatc
gtgcacctgtgcgccatcagcctggaccgctactgggccgtgagccgcgcgctggagtac
aactccaagcgcaccccgcgccgcatcaagtgcatcatcctcactgtgtggctcatcgcc
gccgtcatctcgctgccgcccctcatctacaagggcgaccagggcccccagccgcgcggg
cgcccccagtgcaagctcaaccaggaggcctggtacatcctggcctccagcatcggatct
ttctttgctccttgcctcatcatgatccttgtctacctgcgcatctacctgatcgccaaa
cgcagcaaccgcagaggtcccagggccaagggggggcctgggcagggtgagtccaagcag
ccccgacccgaccatggtggggctttggcctcagccaaactgccagccctggcctctgtg
gcttctgccagagaggtcaacggacactcgaagtccactggggagaaggaggagggggag
acccctgaagatactgggacccgggccttgccacccagttgggctgcccttcccaactca
ggccagggccagaaggagggtgtttgtggggcatctccagaggatgaagctgaagaggag
gaagaggaggaggaggaggaggaagagtgtgaaccccaggcagtgccagtgtctccggcc
tcagcttgcagccccccgctgcagcagccacagggctcccgggtgctggccaccctacgt
ggccaggtgctcctgggcaggggcgtgggtgctataggtgggcagtggtggcgtcgacgg
gcgcagctgacccgggagaagcgcttcaccttcgtgctggctgtggtcattggcgttttt
gtgctctgctggttccccttcttcttcagctacagcctgggagccatctgcccgaagcac
tgcaaggtgccccatggcctcttccagttcttcttctggatcggctactgcaacagctca
ctgaaccctgttatctacaccatcttcaaccaggacttccgccgtgccttccggaggatc
ctgtgccgcccgtggacccagacggcctggtga

DBGET integrated database retrieval system