KEGG   Homo sapiens (human): 151056Help
Entry
151056            CDS       T01001                                 

Gene name
PLB1, PLB, PLB/LIP, hPLB
Definition
phospholipase B1 (EC:3.1.1.5 3.1.1.4)
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    151056 (PLB1)
   00565 Ether lipid metabolism
    151056 (PLB1)
   00590 Arachidonic acid metabolism
    151056 (PLB1)
   00591 Linoleic acid metabolism
    151056 (PLB1)
   00592 alpha-Linolenic acid metabolism
    151056 (PLB1)
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    151056 (PLB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     151056 (PLB1)
    3.1.1.5  lysophospholipase
     151056 (PLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23.2
AA seq 1447 aa AA seqDB search
MGLRPGIFLLELLLLLGQGTPQIHTSPRKSTLEGQLWPETLKNSPFPCNPNKLGVNMPSK
SVHSLKPSDIKFVAAIGNLEIPPDPGTGDLEKQDWTERPQQVCMGVMTVLSDIIRYFSPS
VPMPVCHTGKRVIPHDGAEDLWIQAQELVRNMKENLQLDFQFDWKLINVFFSNASQCYLC
PSAQQAPSLSTVLLSQNGLAAGGVDELMGVLDYLQQEVPRAFVNLVDLSEVAEVSRQYHG
TWLSPAPEPCNCSEETTRLAKVVMQWSYQEAWNSLLASSRYSEQESFTVVFQPFFYETTP
SLHSEDPRLQDSTTLAWHLWNRMMEPAGEKDEPLSVKHGRPMKCPSQESPYLFSYRNSNY
LTRLQKPQDKLEVREGAEIRCPDKDPSDTVPTSVHRLKPADINVIGALGDSLTAGNGAGS
TPGNVLDVLTQYRGLSWSVGGDENIGTVTTLANILREFNPSLKGFSVGTGKETSPNAFLN
QAVAGGRAEDLPVQARRLVDLMKNDTRIHFQEDWKIITLFIGGNDLCDFCNDLVPRAFVN
LVTVLEIVNLRELYQEKKVYCPRMILRSLCPCVLKFDDNSTELATLIEFNKKFQEKTHQL
IESGRYDTREDFTVVVQPFFENVDMPKTSEGLPDNSFFAPDCFHFSSKSHSRAASALWNN
MLEPVGQKTTRHKFENKINITCPNQVQPFLRTYKNSMQGHGTWLPCRDRAPSALHPTSVH
ALRPADIQVVAALGDSLTAGNGIGSKPDDLPDVTTQYRGLSYSAGGDGSLENVTTLPNIL
REFNRNLTGYAVGTGDANDTNAFLNQAVPGAKAEDLMSQVQTLMQKMKDDHRVNFHEDWK
VITVLIGGSDLCDYCTDSNLYSAANFVHHLRNALDVLHREVPRVLVNLVDFLNPTIMRQV
FLGNPDKCPVQQASVLCNCVLTLRENSQELARLEAFSRAYRSSMRELVGSGRYDTQEDFS
VVLQPFFQNIQLPVLADGLPDTSFFAPDCIHPNQKFHSQLARALWTNMLEPLGSKTETLD
LRAEMPITCPTQNEPFLRTPRNSNYTYPIKPAIENWGSDFLCTEWKASNSVPTSVHQLRP
ADIKVVAALGDSLTTAVGARPNNSSDLPTSWRGLSWSIGGDGNLETHTTLPNILKKFNPY
LLGFSTSTWEGTAGLNVAAEGARARDMPAQAWDLVERMKNSPDINLEKDWKLVTLFIGVN
DLCHYCENPEAHLATEYVQHIQQALDILSEELPRAFVNVVEVMELASLYQGQGGKCAMLA
AQNNCTCLRHSQSSLEKQELKKVNWNLQHGISSFSYWHQYTQREDFAVVVQPFFQNTLTP
LNERGDTDLTFFSEDCFHFSDRGHAEMAIALWNNMLEPVGRKTTSNNFTHSRAKLKCPSP
ESPYLYTLRNSRLLPDQAEEAPEVLYWAVPVAAGVGLVVGIIGTVVWRCRRGGRREDPPM
SLRTVAL
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcggccaggcattttcctcctggagctgctgctgcttctggggcaagggacc
cctcagatccatacctctcctagaaagagtacattggaagggcagctatggccagagacc
ctgaagaattctccattcccatgcaacccaaataaattaggagtgaatatgccttctaaa
tcagttcactctctgaagccttctgatattaaatttgtggcagccattggcaatctggaa
attcctccagacccagggacgggcgatctggagaagcaagactggactgaaaggccacag
caggtgtgcatgggagtgatgacagtcctttcagacatcatcagatatttcagtccttct
gttccaatgcctgtgtgccacactggaaagagagtcataccccacgatggtgctgaagac
ttgtggattcaggctcaagaactggtgagaaacatgaaagagaacctgcaacttgacttt
caatttgactggaagctcatcaatgtgttcttcagtaatgcaagccagtgttacctgtgc
ccctctgctcaacaggcaccctcacttagcacggttctcctctcacagaatgggcttgcg
gcgggcggcgtggatgagctgatgggggtgctggactacctgcagcaggaggtccccaga
gcatttgtaaacctggtggacctctctgaggttgcagaggtctctcgtcagtatcacggc
acttggctcagccctgcaccagagccctgtaattgctcagaggagaccacccggctggcc
aaggtggtgatgcagtggtcttatcaggaagcctggaacagcctcctggcctccagcagg
tacagtgagcaggagtccttcaccgtggttttccagcctttcttctatgagaccacccca
tctctacactcggaggacccccgactccaggattctaccacgctggcctggcatctctgg
aataggatgatggagccagcaggagagaaagatgagccattgagtgtaaaacacgggagg
ccaatgaagtgtccctctcaggagagcccctatctgttcagctacagaaacagcaactac
ctgaccagactgcagaaaccccaagacaagcttgaggtaagagaaggagcggaaatcaga
tgtcctgacaaagacccctccgatacggttcccacctcagttcataggctgaagccggct
gacatcaacgtaattggagccctgggtgactctctcacggcaggcaatggggccgggtcc
acacctgggaacgtcttggacgtcttgactcagtaccgaggcctgtcctggagcgtcggc
ggagatgagaacatcggcaccgttaccaccctggcgaacatcctccgggaattcaaccct
tccctgaagggcttctctgttggcactgggaaagaaaccagtcctaatgccttcttaaac
caggctgtggcaggaggccgagctgaggatctacctgtccaggccaggaggctggtggac
ctgatgaagaatgacacgaggatacactttcaggaagactggaagataataaccctgttt
ataggcggcaatgacctctgtgatttctgcaatgatctggttcctcgggcatttgtgaac
ctggtgacggtgcttgagatcgtcaacctgagggagctgtaccaggagaaaaaagtctac
tgcccaaggatgatcctcaggtctctgtgtccctgtgtcctgaagtttgatgataactca
acagaacttgctaccctcatcgaattcaacaagaagtttcaggagaagacccaccaactg
attgagagtgggcgatatgacacaagggaagattttactgtggttgtgcagccgttcttt
gaaaacgtggacatgccaaagacctcggaaggattgcctgacaactctttcttcgctcct
gactgtttccacttcagcagcaagtctcactcccgagcagccagtgctctctggaacaat
atgctggagcctgttggccagaagacgactcgtcataagtttgaaaacaagatcaatatc
acatgtccgaaccaggtccagccgtttctgaggacctacaagaacagcatgcagggtcat
gggacctggctgccatgcagggacagagccccttctgccttgcaccctacctcagtgcat
gccctgagacctgcagacatccaagttgtggctgctctgggggattctctgaccgctggc
aatggaattggctccaaaccagacgacctccccgatgtcaccacacagtatcggggactg
tcatacagtgcaggaggggacggctccctggagaatgtgaccaccttacctaatatcctt
cgggagtttaacagaaacctcacaggctacgccgtgggcacgggtgatgccaatgacacg
aatgcattcctcaatcaagctgttcccggagcaaaggctgaggatcttatgagccaagtc
caaactctgatgcagaagatgaaagatgatcatagagtaaatttccatgaagactggaag
gtcatcacagtgctgatcggaggcagcgatttatgtgactactgcacagattcgaatctg
tattctgcagccaactttgttcaccatctccgcaatgccttggacgtcctgcatagagag
gtgcccagagtcctggtcaacctcgtggacttcctgaaccccactatcatgcggcaggtg
ttcctgggaaacccagacaagtgcccagtgcagcaggccagcgttttgtgtaactgcgtt
ctgaccctgcgggagaactcccaagagctagccaggctggaggccttcagccgagcctac
cggagcagcatgcgcgagctggtggggtcaggccgctatgacacgcaggaggacttctct
gtggtgctgcagcccttcttccagaacatccagctccctgtcctggcggatgggctccca
gatacgtccttctttgccccagactgcatccacccaaatcagaaattccactcccagctg
gccagagccctttggaccaatatgcttgaaccacttggaagcaaaacagagaccctggac
ctgagagcagagatgcccatcacctgtcccactcagaatgagcccttcctgagaacccct
cggaatagtaactacacgtaccccatcaagccagccattgagaactggggcagtgacttc
ctgtgtacagagtggaaggcttccaatagtgttccaacctctgtccaccagctccgacca
gcagacatcaaagtggtggccgccctgggtgactctctgactacagcagtgggagctcga
ccaaacaactccagtgacctacccacatcttggaggggactctcttggagcattggaggg
gatgggaacttggagactcacaccacactgcccaacattctgaagaagttcaacccttac
ctccttggcttctctaccagcacctgggaggggacagcaggactaaatgtggcagcggaa
ggggccagagctagggacatgccagcccaggcctgggacctggtagagcgaatgaaaaac
agccccgacatcaacctggagaaagactggaagctggtcacactcttcattggggtcaac
gacttgtgtcattactgtgagaatccggaggcccacttggccacggaatatgttcagcac
atccaacaggccctggacatcctctctgaggagctcccaagggctttcgtcaacgtggtg
gaggtcatggagctggctagcctgtaccagggccaaggcgggaaatgtgccatgctggca
gctcagaacaactgcacttgcctcagacactcgcaaagctccctggagaagcaagaactg
aagaaagtgaactggaacctccagcatggcatctccagtttctcctactggcaccaatac
acacagcgtgaggactttgcggttgtggtgcagcctttcttccaaaacacactcacccca
ctgaacgagagaggggacactgacctcaccttcttctccgaggactgttttcacttctca
gaccgcgggcatgccgagatggccatcgcactctggaacaacatgctggaaccagtgggc
cgcaagactacctccaacaacttcacccacagccgagccaaactcaagtgcccctctcct
gagagcccttacctctacaccctgcggaacagccgattgctcccagaccaggctgaagaa
gcccccgaggtgctctactgggctgtcccagtggcagcgggagtcggccttgtggtgggc
atcatcgggacagtggtctggaggtgcaggagaggtggccggagggaagatcctccaatg
agcctgcgcactgtggccctctag

  All links  
No link information was found.   
DBGET integrated database retrieval system