KEGG   Homo sapiens (human): 1511Help
Entry
1511              CDS       T01001                                 

Gene name
CTSG, CATG, CG
Definition
cathepsin G (EC:3.4.21.20)
Orthology
K01319  
cathepsin G [EC:3.4.21.20]
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Lysosome
Renin-angiotensin system
Amoebiasis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1511 (CTSG)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1511 (CTSG)
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    1511 (CTSG)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    1511 (CTSG)
  Infectious diseases
   05146 Amoebiasis
    1511 (CTSG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.20  cathepsin G
     1511 (CTSG)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   1511 (CTSG)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Others
  1511 (CTSG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q11.2
AA seq 255 aa AA seqDB search
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcagccactcctgcttctgctggcctttctcctacccactggggctgaggcaggggag
atcatcggaggccgggagagcaggccccactcccgcccctacatggcgtatcttcagatc
cagagtccagcaggtcagagcagatgtggagggttcctggtgcgagaagactttgtgctg
acagcagctcattgctggggaagcaatataaatgtcaccctgggcgcccacaatatccag
agacgggaaaacacccagcaacacatcactgcgcgcagagccatccgccaccctcaatat
aatcagcggaccatccagaatgacatcatgttattgcagctgagcagaagagtcagacgg
aatcgaaacgtgaacccagtggctctgcctagagcccaggagggactgagacccgggacg
ctgtgcactgtggccggctggggcagggtcagcatgaggaggggaacagatacactccga
gaggtgcagctgagagtgcagagggataggcagtgcctccgcatcttcggttcctacgac
ccccgaaggcagatttgtgtgggggaccggcgggaacggaaggctgccttcaagggggat
tccggaggccccctgctgtgtaacaatgtggcccacggcatcgtctcctatggaaagtcg
tcaggggttcctccagaagtcttcaccagggtctcaagtttcctgccctggataaggaca
acaatgagaagcttcaaactgctggatcagatggagacccccctgtga

DBGET integrated database retrieval system