KEGG   Homo sapiens (human): 151258Help
Entry
151258            CDS       T01001                                 

Gene name
SLC38A11, AVT2
Definition
(RefSeq) solute carrier family 38 member 11
  KO
K14997  
solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 11
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   151258 (SLC38A11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24.3
AA seq 406 aa AA seqDB search
MKQAGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQF
LYPFIAMISYNIIAGDTLSKVFQRIPGVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAK
LGKVSLISTGLTTLILGIVMARAISLGPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHN
SFLVYSSLEEPTVAKWSRLIHMSIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDL
VTFGRFCYGVTVILTYPMECFVTREVIANVFFGGNLSSVFHIVVTVMVITVATLVSLLID
CLGIVLELNGVLCATPLIFIIPSACYLKLSEEPRTHSDKIMSCVMLPIGAVVMVFGFVMA
ITNTQDCTHGQEMFYCFPDNFSLTNTSESHVQQTTQLSTLNISIFQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagctgggtttcctttgggaatattgcttttattctgggtttcatatgttaca
gacttttcccttgttttattgataaaaggaggggccctctctggaacagatacctaccag
tctttggtcaataaaactttcggctttccagggtatctgctcctctctgttcttcagttt
ttgtatccttttatagcaatgataagttacaatataatagctggagatactttgagcaaa
gtttttcaaagaatcccaggagttgatcctgaaaacgtgtttattggtcgccacttcatt
attggactttccacagttacctttactctgcctttatccttgtaccgaaatatagcaaag
cttggaaaggtctccctcatctctacaggtttaacaactctgattcttggaattgtaatg
gcaagggcaatttcactgggtccacacataccaaaaacagaagacgcttgggtatttgca
aagcccaatgccattcaagcggtcggggttatgtcttttgcatttatttgccaccataac
tccttcttagtttacagttctctagaagaacccacagtagctaagtggtcccgccttatc
catatgtccatcgtgatttctgtatttatctgtatattctttgctacatgtggatacttg
acatttactggcttcacccaaggggacttatttgaaaattactgcagaaatgatgacctg
gtaacatttggaagattttgttatggtgtcactgtcattttgacataccctatggaatgc
tttgtgacaagagaggtaattgccaatgtgttttttggtgggaatctttcatcggttttc
cacattgttgtaacagtgatggtcatcactgtagccacgcttgtgtcattgctgattgat
tgcctcgggatagttctagaactcaatggtgtgctctgtgcaactcccctcatttttatc
attccatcagcctgttatctgaaactgtctgaagaaccaaggacacactccgataagatt
atgtcttgtgtcatgcttcccattggtgctgtggtgatggtttttggattcgtcatggct
attacaaatactcaagactgcacccatgggcaggaaatgttctactgctttcctgacaat
ttctctctcacaaatacctcagagtctcatgttcagcagacaacacaactttctacttta
aatattagtatctttcaatga

DBGET integrated database retrieval system