KEGG   Homo sapiens (human): 1513Help
Entry
1513              CDS       T01001                                 

Gene name
CTSK, CTS02, CTSO, CTSO1, CTSO2, PKND, PYCD
Definition
cathepsin K (EC:3.4.22.38)
Orthology
K01371  
cathepsin K [EC:3.4.22.38]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Osteoclast differentiation
Toll-like receptor signaling pathway
Rheumatoid arthritis
Disease
H00273  
Pycnodysostosis
H00425  
Lysosomal cysteine protease deficiencies
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1513 (CTSK)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    1513 (CTSK)
  Development
   04380 Osteoclast differentiation
    1513 (CTSK)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    1513 (CTSK)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.38  cathepsin K
     1513 (CTSK)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   1513 (CTSK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 329 aa AA seqDB search
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggctcaaggttctgctgctacctgtggtgagctttgctctgtaccctgaggag
atactggacacccactgggagctatggaagaagacccacaggaagcaatataacaacaag
gtggatgaaatctctcggcgtttaatttgggaaaaaaacctgaagtatatttccatccat
aaccttgaggcttctcttggtgtccatacatatgaactggctatgaaccacctgggggac
atgaccagtgaagaggtggttcagaagatgactggactcaaagtacccctgtctcattcc
cgcagtaatgacaccctttatatcccagaatgggaaggtagagccccagactctgtcgac
tatcgaaagaaaggatatgttactcctgtcaaaaatcagggtcagtgtggttcctgttgg
gcttttagctctgtgggtgccctggagggccaactcaagaagaaaactggcaaactctta
aatctgagtccccagaacctagtggattgtgtgtctgagaatgatggctgtggagggggc
tacatgaccaatgccttccaatatgtgcagaagaaccggggtattgactctgaagatgcc
tacccatatgtgggacaggaagagagttgtatgtacaacccaacaggcaaggcagctaaa
tgcagagggtacagagagatccccgaggggaatgagaaagccctgaagagggcagtggcc
cgagtgggacctgtctctgtggccattgatgcaagcctgacctccttccagttttacagc
aaaggtgtgtattatgatgaaagctgcaatagcgataatctgaaccatgcggttttggca
gtgggatatggaatccagaagggaaacaagcactggataattaaaaacagctggggagaa
aactggggaaacaaaggatatatcctcatggctcgaaataagaacaacgcctgtggcatt
gccaacctggccagcttccccaagatgtga

DBGET integrated database retrieval system