KEGG   Homo sapiens (human): 1513Help
Entry
1513              CDS       T01001                                 

Gene name
CTSK, CTS02, CTSO, CTSO1, CTSO2, PKND, PYCD
Definition
cathepsin K (EC:3.4.22.38)
Orthology
K01371  
cathepsin K [EC:3.4.22.38]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Osteoclast differentiation
Toll-like receptor signaling pathway
Rheumatoid arthritis
Disease
H00273  
Pycnodysostosis
H00425  
Lysosomal cysteine protease deficiencies
Drug target
Other: 
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 329 aa AA seqDB search
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggctcaaggttctgctgctacctgtggtgagctttgctctgtaccctgaggag
atactggacacccactgggagctatggaagaagacccacaggaagcaatataacaacaag
gtggatgaaatctctcggcgtttaatttgggaaaaaaacctgaagtatatttccatccat
aaccttgaggcttctcttggtgtccatacatatgaactggctatgaaccacctgggggac
atgaccagtgaagaggtggttcagaagatgactggactcaaagtacccctgtctcattcc
cgcagtaatgacaccctttatatcccagaatgggaaggtagagccccagactctgtcgac
tatcgaaagaaaggatatgttactcctgtcaaaaatcagggtcagtgtggttcctgttgg
gcttttagctctgtgggtgccctggagggccaactcaagaagaaaactggcaaactctta
aatctgagtccccagaacctagtggattgtgtgtctgagaatgatggctgtggagggggc
tacatgaccaatgccttccaatatgtgcagaagaaccggggtattgactctgaagatgcc
tacccatatgtgggacaggaagagagttgtatgtacaacccaacaggcaaggcagctaaa
tgcagagggtacagagagatccccgaggggaatgagaaagccctgaagagggcagtggcc
cgagtgggacctgtctctgtggccattgatgcaagcctgacctccttccagttttacagc
aaaggtgtgtattatgatgaaagctgcaatagcgataatctgaaccatgcggttttggca
gtgggatatggaatccagaagggaaacaagcactggataattaaaaacagctggggagaa
aactggggaaacaaaggatatatcctcatggctcgaaataagaacaacgcctgtggcatt
gccaacctggccagcttccccaagatgtga

DBGET integrated database retrieval system