KEGG   Homo sapiens (human): 151306Help
Entry
151306            CDS       T01001                                 

Gene name
GPBAR1, BG37, GPCR19, GPR131, M-BAR, TGR5
Definition
(RefSeq) G protein-coupled bile acid receptor 1
  KO
K08400  
G protein-coupled bile acid receptor 1
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Lipid
   Bile acid
    151306 (GPBAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 330 aa AA seqDB search
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccaacagcactggcgaggtgcccagccccattcccaagggggctttggggctc
tccctggccctggcaagcctcatcatcaccgcgaacctgctcctagccctgggcatcgcc
tgggaccgccgcctgcgcagcccacctgctggctgcttcttcctgagcctactgctggct
gggctgctcacgggtctggcattgcccacattgccagggctgtggaaccagagtcgccgg
ggttactggtcctgcctcctcgtctacttggctcccaacttctccttcctctccctgctt
gccaacctcttgctggtgcacggggagcgctacatggcagtcctgaggccactccagccc
cctgggagcattcggctggccctgctcctcacctgggctggtcccctgctctttgccagt
ctgcccgctctggggtggaaccactggacccctggtgccaactgcagctcccaggctatc
ttcccagccccctacctgtacctcgaagtctatgggctcctgctgcccgccgtgggtgct
gctgccttcctctctgtccgcgtgctggccactgcccaccgccagctgcaggacatctgc
cggctggagcgggcagtgtgccgcgatgagccctccgccctggcccgggcccttacctgg
aggcaggcaagggcacaggctggagccatgctgctcttcgggctgtgctgggggccctac
gtggccacactgctcctctcagtcctggcctatgagcagcgcccgccactggggcctggg
acactgttgtccctcctctccctaggaagtgccagtgcagcggcagtgcccgtagccatg
gggctgggcgatcagcgctacacagccccctggagggcagccgcccaaaggtgcctgcag
gggctgtggggaagagcctcccgggacagtcccggccccagcattgcctaccacccaagc
agccaaagcagtgtcgacctggacttgaactaa

DBGET integrated database retrieval system