KEGG   Homo sapiens (human): 151473Help
Entry
151473            CDS       T01001                                 

Gene name
SLC16A14, MCT14
Definition
(RefSeq) solute carrier family 16 member 14
  KO
K08190  MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 14
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC16: Monocarboxylate transporter
   151473 (SLC16A14)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Monocarboxylate porter (MCP) family [TC:2.A.1.13]
    151473 (SLC16A14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 151473
NCBI-ProteinID: NP_689740
HGNC: 26417
Ensembl: ENSG00000163053
Vega: OTTHUMG00000133205
Pharos: Q7RTX9(Tdark)
UniProt: Q7RTX9
Position
2q36.3
AA seq 510 aa AA seqDB search
MYTSHEDIGYDFEDGPKDKKTLKPHPNIDGGWAWMMVLSSFFVHILIMGSQMALGVLNVE
WLEEFHQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYA
ANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLK
YLCAEYGWRNAMLIQGAVSLNLCVCGALMRPLSPGKNPNDPGEKDVRGLPAHSTESVKST
GQQGRTEEKDGGLGNEETLCDLQAQECPDQAGHRKNMCALRILKTVSWLTMRVRKGFEDW
YSGYFGTASLFTNRMFVAFIFWALFAYSSFVIPFIHLPEIVNLYNLSEQNDVFPLTSIIA
IVHIFGKVILGVIADLPCISVWNVFLLANFTLVLSIFILPLMHTYAGLAVICALIGFSSG
YFSLMPVVTEDLVGIEHLANAYGIIICANGISALLGPPFAGWIYDITQKYDFSFYICGLL
YMIGILFLLIQPCIRIIEQSRRKYMDGAHV
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtataccagtcatgaagatattgggtatgattttgaagatggccccaaagacaaaaag
acactgaagccccacccaaacattgatggcggatgggcttggatgatggtgctctcctct
ttctttgtgcacatcctcatcatgggctcccagatggccctgggtgtcctcaacgtggaa
tggctggaagaattccaccagagccgcggcctgaccgcctgggtcagctccctcagcatg
ggcatcaccttgatagtgggccctttcatcggcttgttcattaacacctgtgggtgccgc
cagactgcgatcattggagggctcgtcaactccctgggctgggtgttgagtgcctatgct
gcaaacgtgcattatctcttcattacttttggagtcgcagctggcctgggcagcgggatg
gcctacctgccagcggtggtcatggtgggcaggtatttccagaagagacgcgccctcgcc
cagggcctcagcaccacggggaccggattcggtacgttcctaatgactgtgctgctgaag
tacctgtgcgcagagtacggctggaggaatgccatgttgatccaaggtgccgtttcccta
aacctgtgtgtttgtggggcgctcatgaggcccctctctcctggtaaaaacccaaacgac
ccaggagagaaagatgtgcgtggcctgccagcgcactccacagaatctgtgaagtcaact
ggacagcagggaagaacagaagagaaggatggtgggctcgggaacgaggagaccctctgc
gacctgcaagcccaggagtgccccgatcaggccgggcacaggaagaacatgtgtgccctc
cggattctgaagactgtcagctggctcaccatgagagtcaggaagggcttcgaggactgg
tattcgggctactttgggacagcctctctatttacaaatcgaatgtttgtagcctttatt
ttctgggctttgtttgcatacagcagctttgtcatccccttcattcacctcccagaaatc
gtcaatttgtataacttatcggagcaaaacgacgttttccctctgacgtcaattatagca
atagttcacatctttggaaaagtgatcctgggcgtcatagccgacttgccttgcattagt
gtttggaatgtcttcctgttggccaacttcacccttgtcctcagtatttttattctgccg
ttgatgcacacgtacgctggcctggcggtcatctgtgcgctgatagggttttccagtggt
tatttctccctaatgcccgtagtgactgaagacttggttggcattgaacacctggccaat
gcctacggcatcatcatctgtgctaatggcatctctgcattgctgggaccaccttttgca
gggtggatctatgacatcacgcaaaaatatgatttttccttctacatatgtggtttgctt
tacatgataggaatactctttttacttattcagccgtgcattcgaattatagaacaatcc
agaagaaaatacatggatggtgcacatgtttag

DBGET integrated database retrieval system