KEGG   Homo sapiens (human): 1515Help
Entry
1515              CDS       T01001                                 

Gene name
CTSV, CATL2, CTSL2, CTSU
Definition
(RefSeq) cathepsin V (EC:3.4.22.43)
  KO
K01375  
cathepsin V [EC:3.4.22.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1515 (CTSV)
  Cell growth and death
   04210 Apoptosis
    1515 (CTSV)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.43  cathepsin V
     1515 (CTSV)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   1515 (CTSV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q22.2
AA seq 334 aa AA seqDB search
MNLSLVLAAFCLGIASAVPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIE
LHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDW
RKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNG
GFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAV
ATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVK
NSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttcgctcgtcctggctgccttttgcttgggaatagcctccgctgttccaaaa
tttgaccaaaatttggatacaaagtggtaccagtggaaggcaacacacagaagattatat
ggcgcgaatgaagaaggatggaggagagcagtgtgggaaaagaatatgaaaatgattgaa
ctgcacaatggggaatacagccaagggaaacatggcttcacaatggccatgaatgctttt
ggtgacatgaccaatgaagaattcaggcagatgatgggttgctttcgaaaccagaaattc
aggaaggggaaagtgttccgtgagcctctgtttcttgatcttcccaaatctgtggattgg
agaaagaaaggctacgtgacgccagtgaagaatcagaaacagtgtggttcttgttgggct
tttagtgcgactggtgctcttgaaggacagatgttccggaaaactgggaaacttgtctca
ctgagcgagcagaatctggtggactgttcgcgtcctcaaggcaatcagggctgcaatggt
ggcttcatggctagggccttccagtatgtcaaggagaacggaggcctggactctgaggaa
tcctatccatatgtagcagtggatgaaatctgtaagtacagacctgagaattctgttgct
aatgacactggcttcacagtggtcgcacctggaaaggagaaggccctgatgaaagcagtc
gcaactgtggggcccatctccgttgctatggatgcaggccattcgtccttccagttctac
aaatcaggcatttattttgaaccagactgcagcagcaaaaacctggatcatggtgttctg
gtggttggctacggctttgaaggagcaaattcgaataacagcaagtattggctcgtcaaa
aacagctggggtccagaatggggctcgaatggctatgtaaaaatagccaaagacaagaac
aaccactgtggaatcgccacagcagccagctaccccaatgtgtga

DBGET integrated database retrieval system