KEGG   Homo sapiens (human): 151636Help
Entry
151636            CDS       T01001                                 

Gene name
DTX3L, BBAP
Definition
deltex 3 like, E3 ubiquitin ligase
Orthology
K06058  
deltex
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    151636 (DTX3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21.1
AA seq 740 aa AA seqDB search
MASHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSE
RAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAETPSGDMHQHE
GHIPNAVDSCLQKIFLTVTADLNCNLFSKEQRAYITTLCPSIRKMEGHDGIEKVCGDFQD
IERIHQFLSEQFLESEQKQQFSPSMTERKPLSQQERDSCISPSEPETKAEQKSNYFEVPL
PYFEYFKYICPDKINSIEKRFGVNIEIQESSPNMVCLDFTSSRSGDLEAARESFASEFQK
NTEPLKQECVSLADSKQANKFKQELNHQFTKLLIKEKGGELTLLGTQDDISAAKQKISEA
FVKIPVKLFAANYMMNVIEVDSAHYKLLETELLQEISEIEKRYDICSKVSEKGQKTCILF
ESKDRQVDLSVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTKFADDFRKRHPN
VHFVLNQESMTLTGLPNHLAKAKQYVLKGGGMSSLAGKKLKEGHETPMDIDSDDSKAASP
PLKGSVSSEASELDKKEKGICVICMDTISNKKVLPKCKHEFCAPCINKAMSYKPICPTCQ
TSYGIQKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQR
TAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYG
YPDPSYLKRVKEELKAKGIE
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccacctgcgcccgccgtccccgctcctcgtgcgggtgtacaagtccggcccc
cgagtacgaaggaagctggagagctacttccagagctctaagtcctcgggcggcggggag
tgcacggtcagcacccaggaacacgaagccccgggcaccttccgggtggagttcagtgaa
agggcagctaaggagagagtgttgaaaaaaggagagcaccaaatacttgttgacgaaaaa
cctgtgcccattttcctggtacccactgaaaattcaataaagaagaacacgagacctcaa
atttcttcactgacacaatcacaagcagaaacaccgtctggtgatatgcatcaacatgaa
ggacatattcctaatgctgtggattcctgtctccaaaagatctttcttactgtaacagct
gacctgaactgtaacctgttctccaaagagcagagggcatacataaccacactgtgccct
agtatcagaaaaatggaaggtcacgatggaattgagaaggtgtgtggtgacttccaagac
attgaaagaatacatcaatttttgagtgagcagttcctggaaagtgagcagaaacaacaa
ttttccccttcaatgacagagaggaagccactcagtcagcaggagagggacagctgcatt
tctccttctgaaccagaaaccaaggcagaacaaaaaagcaactattttgaagttcccttg
ccttactttgaatactttaaatatatctgtcctgataaaatcaactcaatagagaaaaga
tttggtgtaaacattgaaatccaggagagttctccaaatatggtctgtttagatttcacc
tcaagtcgatcaggtgacctggaagcagctcgtgagtcttttgctagtgaatttcagaag
aacacagaacctctgaagcaagaatgtgtctctttagcagacagtaagcaggcaaataaa
ttcaaacaggaattgaatcaccagtttacaaagctccttataaaggagaaaggaggcgaa
ttaactctccttgggacccaagatgacatttcagctgccaaacaaaaaatctctgaagct
tttgtcaagatacctgtgaaactatttgctgccaattacatgatgaatgtaattgaggtt
gatagtgcccactataaacttttagaaactgaattactacaggagatatcagagatcgaa
aaaaggtatgacatttgcagcaaggtttctgagaaaggtcagaaaacctgcattctgttt
gaatccaaggacaggcaggtagatctatctgtgcatgcttatgcaagtttcatcgatgcc
tttcaacatgcctcatgtcagttgatgagagaagttcttttactgaagtctttgggcaag
gagagaaagcacttacatcagaccaagtttgctgatgactttagaaaaagacatccaaat
gtacactttgtgctaaatcaagagtcaatgactttgactggtttgccaaatcaccttgca
aaggcgaagcagtatgttctaaaaggaggaggaatgtcttcattggctggaaagaaattg
aaagagggtcatgaaacaccgatggacattgatagcgatgattccaaagcagcttctccg
ccactcaagggctctgtgagttctgaggcctcagaactggacaagaaggaaaagggcatc
tgtgtcatctgtatggacaccattagtaacaaaaaagtgctaccaaagtgcaagcatgaa
ttctgcgccccttgtatcaacaaagccatgtcatataagccaatctgtcccacatgccag
acttcctatggtattcagaaaggaaatcagccagagggaagcatggttttcactgtttca
agagactcacttccaggttatgagtcctttggcaccattgtgattacttattctatgaaa
gcaggcatacaaacagaagaacacccaaacccaggaaagagataccctggaatacagcga
actgcatacttgcctgataataaggaaggaaggaaggttttgaaactgctttatagggcc
tttgaccaaaagctgatttttacagtggggtactctcgcgtattaggagtctcagatgtc
atcacttggaatgatattcaccacaaaacatcccggtttggaggaccagaaatgtatggc
tatcctgatccttcttacctgaaacgtgtcaaagaggagctgaaagccaaaggaattgag
taa

DBGET integrated database retrieval system