KEGG   Homo sapiens (human): 151636Help
Entry
151636            CDS       T01001                                 

Gene name
DTX3L, BBAP, RNF143
Definition
(RefSeq) deltex E3 ubiquitin ligase 3L
  KO
K06058  deltex [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    151636 (DTX3L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     151636 (DTX3L)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    151636 (DTX3L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 zf-C3HC4 zf-RING_5 zf-RING_4 zf-RING_6 zf-rbx1 zf-RING_UBOX zf-RING_10 Prok-RING_4 zf-RING_11 DUF4165 zf-UDP
Motif
Other DBs
NCBI-GeneID: 151636
NCBI-ProteinID: NP_612144
OMIM: 613143
HGNC: 30323
Ensembl: ENSG00000163840
Vega: OTTHUMG00000159524
Pharos: Q8TDB6(Tbio)
UniProt: Q8TDB6
Structure
PDB: 

Jmol
Position
3q21.1
AA seq 740 aa AA seqDB search
MASHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSE
RAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAETPSGDMHQHE
GHIPNAVDSCLQKIFLTVTADLNCNLFSKEQRAYITTLCPSIRKMEGHDGIEKVCGDFQD
IERIHQFLSEQFLESEQKQQFSPSMTERKPLSQQERDSCISPSEPETKAEQKSNYFEVPL
PYFEYFKYICPDKINSIEKRFGVNIEIQESSPNMVCLDFTSSRSGDLEAARESFASEFQK
NTEPLKQECVSLADSKQANKFKQELNHQFTKLLIKEKGGELTLLGTQDDISAAKQKISEA
FVKIPVKLFAANYMMNVIEVDSAHYKLLETELLQEISEIEKRYDICSKVSEKGQKTCILF
ESKDRQVDLSVHAYASFIDAFQHASCQLMREVLLLKSLGKERKHLHQTKFADDFRKRHPN
VHFVLNQESMTLTGLPNHLAKAKQYVLKGGGMSSLAGKKLKEGHETPMDIDSDDSKAASP
PLKGSVSSEASELDKKEKGICVICMDTISNKKVLPKCKHEFCAPCINKAMSYKPICPTCQ
TSYGIQKGNQPEGSMVFTVSRDSLPGYESFGTIVITYSMKAGIQTEEHPNPGKRYPGIQR
TAYLPDNKEGRKVLKLLYRAFDQKLIFTVGYSRVLGVSDVITWNDIHHKTSRFGGPEMYG
YPDPSYLKRVKEELKAKGIE
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccacctgcgcccgccgtccccgctcctcgtgcgggtgtacaagtccggcccc
cgagtacgaaggaagctggagagctacttccagagctctaagtcctcgggcggcggggag
tgcacggtcagcacccaggaacacgaagccccgggcaccttccgggtggagttcagtgaa
agggcagctaaggagagagtgttgaaaaaaggagagcaccaaatacttgttgacgaaaaa
cctgtgcccattttcctggtacccactgaaaattcaataaagaagaacacgagacctcaa
atttcttcactgacacaatcacaagcagaaacaccgtctggtgatatgcatcaacatgaa
ggacatattcctaatgctgtggattcctgtctccaaaagatctttcttactgtaacagct
gacctgaactgtaacctgttctccaaagagcagagggcatacataaccacactgtgccct
agtatcagaaaaatggaaggtcacgatggaattgagaaggtgtgtggtgacttccaagac
attgaaagaatacatcaatttttgagtgagcagttcctggaaagtgagcagaaacaacaa
ttttccccttcaatgacagagaggaagccactcagtcagcaggagagggacagctgcatt
tctccttctgaaccagaaaccaaggcagaacaaaaaagcaactattttgaagttcccttg
ccttactttgaatactttaaatatatctgtcctgataaaatcaactcaatagagaaaaga
tttggtgtaaacattgaaatccaggagagttctccaaatatggtctgtttagatttcacc
tcaagtcgatcaggtgacctggaagcagctcgtgagtcttttgctagtgaatttcagaag
aacacagaacctctgaagcaagaatgtgtctctttagcagacagtaagcaggcaaataaa
ttcaaacaggaattgaatcaccagtttacaaagctccttataaaggagaaaggaggcgaa
ttaactctccttgggacccaagatgacatttcagctgccaaacaaaaaatctctgaagct
tttgtcaagatacctgtgaaactatttgctgccaattacatgatgaatgtaattgaggtt
gatagtgcccactataaacttttagaaactgaattactacaggagatatcagagatcgaa
aaaaggtatgacatttgcagcaaggtttctgagaaaggtcagaaaacctgcattctgttt
gaatccaaggacaggcaggtagatctatctgtgcatgcttatgcaagtttcatcgatgcc
tttcaacatgcctcatgtcagttgatgagagaagttcttttactgaagtctttgggcaag
gagagaaagcacttacatcagaccaagtttgctgatgactttagaaaaagacatccaaat
gtacactttgtgctaaatcaagagtcaatgactttgactggtttgccaaatcaccttgca
aaggcgaagcagtatgttctaaaaggaggaggaatgtcttcattggctggaaagaaattg
aaagagggtcatgaaacaccgatggacattgatagcgatgattccaaagcagcttctccg
ccactcaagggctctgtgagttctgaggcctcagaactggacaagaaggaaaagggcatc
tgtgtcatctgtatggacaccattagtaacaaaaaagtgctaccaaagtgcaagcatgaa
ttctgcgccccttgtatcaacaaagccatgtcatataagccaatctgtcccacatgccag
acttcctatggtattcagaaaggaaatcagccagagggaagcatggttttcactgtttca
agagactcacttccaggttatgagtcctttggcaccattgtgattacttattctatgaaa
gcaggcatacaaacagaagaacacccaaacccaggaaagagataccctggaatacagcga
actgcatacttgcctgataataaggaaggaaggaaggttttgaaactgctttatagggcc
tttgaccaaaagctgatttttacagtggggtactctcgcgtattaggagtctcagatgtc
atcacttggaatgatattcaccacaaaacatcccggtttggaggaccagaaatgtatggc
tatcctgatccttcttacctgaaacgtgtcaaagaggagctgaaagccaaaggaattgag
taa

DBGET integrated database retrieval system