KEGG   Homo sapiens (human): 151648Help
Entry
151648            CDS       T01001                                 

Gene name
SGO1, CAID, NY-BR-85, SGO, SGOL1
Definition
(RefSeq) shugoshin 1
  KO
K11580  
shugoshin-like 1
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    151648 (SGO1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    Shugoshin
     151648 (SGO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p24.3
AA seq 561 aa AA seqDB search
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDN
NKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSS
GMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKS
TDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFERVGFLDPLVNMHIPEN
VQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANR
RKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREE
NNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGS
KPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTA
SVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVR
EFVSRFPDCRKCKLETHICLR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaagatgcctgaaaaagtcctttcaagatagtcttgaagacataaagaag
cgaatgaaagagaaaaggaataaaaacttggcagagattggcaaacgcaggtcttttata
gctgcaccatgccaaataatcaccaacacttctacactgctgaaaaattaccaagacaac
aacaaaatgttagttttagctttggaaaatgaaaaatccaaagtgaaagaagcccaagat
atcatcctacagctgagaaaagaatgttactatctcacatgtcagctatatgcattgaaa
ggaaaacttacatcacaacaaacagtagaacctgctcagaaccaggaaatatgttcctct
ggaatggaccccaatagtgatgacagctccagaaatttatttgtgaaggatttaccgcaa
attcctcttgaagaaactgaacttccaggacaaggagaatcatttcaaatagaagatcag
atacctactattcctcaagacacactgggagttgattttgattcaggtgaagctaagtct
actgataatgtcttacctagaactgtatctgttcgtagcagtttaaagaaacattgtaac
agtatatgtcagtttgatagcttggatgattttgaaaccagtcatttggcagggaagtct
tttgaattcgaaagagttggatttttagacccactagtaaacatgcacatacctgaaaat
gtacaacacaatgcttgtcaatggagcaaggaccaagttaacttatcaccaaagctgatt
cagccaggaacgtttactaaaacaaaagaagacattttagaatctaaatctgaacaaact
aaaagtaagcaaagagatacacaagaaagaaaaagagaagagaaaagaaaagctaacagg
agaaaatcaaaacgtatgtcaaaatataaagagaataaaagcgaaaataaaaaaactgtt
ccccaaaaaaaaatgcacaaatctgtcagttccaatgatgcttacaattttaatttggaa
gagggtgttcatcttactcctttccgacaaaaagtgagcaatgactctaatagagaagaa
aacaacgagtctgaagtgagcctctgtgaatcaagtggttcaggagatgattccgatgac
ctctatttgcccacttgcaagtacattcagaatcccacgagcaattcagatagaccagtc
accaggcctctagctaaaagagcactgaaatacacagatgaaaaagagacggagggttct
aagccaacaaaaactcctaccactacaccacctgaaactcagcagtcacctcatcttagc
ctgaaggatatcaccaatgtctccttgtatcctgttgtgaaaatcagaagactttctctt
tctccaaaaaagaataaagcaagcccagcagtggctctgcctaaacgtaggtgcacagcc
agcgtgaactataaggagcccaccctcgcttcgaaactgagaagaggggacccttttaca
gatttgtgttttttgaattctcctattttcaagcagaaaaaggatttgagacgttctaaa
aaaagagccctggaggtatcacctgccaaagaagcaatttttattttatattatgttcga
gaatttgtttcgagattcccagactgtaggaaatgtaaacttgaaacccacatctgcttg
aggtaa

DBGET integrated database retrieval system