KEGG   Homo sapiens (human): 151648Help
Entry
151648            CDS       T01001                                 

Gene name
SGOL1, NY-BR-85, SGO, Sgo1
Definition
shugoshin-like 1 (S. pombe)
Orthology
K11580  
shugoshin-like 1
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    151648 (SGOL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p24.3
AA seq 527 aa AA seqDB search
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDN
NKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSS
GMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEDQIPTIPQDTLGVDFDSGEAKS
TDNVLPRTVSVRSSLKKHCNSICQFDSLDDFETSHLAGKSFEFERVGFLDPLVNMHIPEN
VQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANR
RKSKRMSKYKENKSENKKTVPQKKMHKSVSSNDAYNFNLEEGVHLTPFRQKVSNDSNREE
NNESEVSLCESSGSGDDSDDLYLPTCKYIQNPTSNSDRPVTRPLAKRALKYTDEKETEGS
KPTKTPTTTPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTA
SVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKSMKQIQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaagatgcctgaaaaagtcctttcaagatagtcttgaagacataaagaag
cgaatgaaagagaaaaggaataaaaacttggcagagattggcaaacgcaggtcttttata
gctgcaccatgccaaataatcaccaacacttctacactgctgaaaaattaccaagacaac
aacaaaatgttagttttagctttggaaaatgaaaaatccaaagtgaaagaagcccaagat
atcatcctacagctgagaaaagaatgttactatctcacatgtcagctatatgcattgaaa
ggaaaacttacatcacaacaaacagtagaacctgctcagaaccaggaaatatgttcctct
ggaatggaccccaatagtgatgacagctccagaaatttatttgtgaaggatttaccgcaa
attcctcttgaagaaactgaacttccaggacaaggagaatcatttcaaatagaagatcag
atacctactattcctcaagacacactgggagttgattttgattcaggtgaagctaagtct
actgataatgtcttacctagaactgtatctgttcgtagcagtttaaagaaacattgtaac
agtatatgtcagtttgatagcttggatgattttgaaaccagtcatttggcagggaagtct
tttgaattcgaaagagttggatttttagacccactagtaaacatgcacatacctgaaaat
gtacaacacaatgcttgtcaatggagcaaggaccaagttaacttatcaccaaagctgatt
cagccaggaacgtttactaaaacaaaagaagacattttagaatctaaatctgaacaaact
aaaagtaagcaaagagatacacaagaaagaaaaagagaagagaaaagaaaagctaacagg
agaaaatcaaaacgtatgtcaaaatataaagagaataaaagcgaaaataaaaaaactgtt
ccccaaaaaaaaatgcacaaatctgtcagttccaatgatgcttacaattttaatttggaa
gagggtgttcatcttactcctttccgacaaaaagtgagcaatgactctaatagagaagaa
aacaacgagtctgaagtgagcctctgtgaatcaagtggttcaggagatgattccgatgac
ctctatttgcccacttgcaagtacattcagaatcccacgagcaattcagatagaccagtc
accaggcctctagctaaaagagcactgaaatacacagatgaaaaagagacggagggttct
aagccaacaaaaactcctaccactacaccacctgaaactcagcagtcacctcatcttagc
ctgaaggatatcaccaatgtctccttgtatcctgttgtgaaaatcagaagactttctctt
tctccaaaaaagaataaagcaagcccagcagtggctctgcctaaacgtaggtgcacagcc
agcgtgaactataaggagcccaccctcgcttcgaaactgagaagaggggacccttttaca
gatttgtgttttttgaattctcctattttcaagcagaaaaaggatttgagacgttctaaa
aaaagtatgaaacaaatacaatga

DBGET integrated database retrieval system