KEGG   Homo sapiens (human): 1519Help
Entry
1519              CDS       T01001                                 

Gene name
CTSO, CTSO1
Definition
cathepsin O (EC:3.4.22.42)
Orthology
K01374  
cathepsin O [EC:3.4.22.42]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1519 (CTSO)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     1519 (CTSO)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   1519 (CTSO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q32.1
AA seq 321 aa AA seqDB search
MDVRALPWLPWLLWLLCRGGGDADSRAPFTPTWPRSREREAAAFRESLNRHRYLNSLFPS
ENSTAFYGINQFSYLFPEEFKAIYLRSKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVV
TQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALN
WLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGP
LVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGY
AHVKMGSNVCGIADSVSSIFV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgcgggcgctgccgtggctgccgtggctgctgtggctgctgtgccggggcggc
ggcgatgcggactcccgcgcccccttcaccccgacctggccgcggagccgcgagcgtgaa
gccgccgccttccgggaaagtcttaatagacatcgatacttgaattctttatttcccagt
gaaaactccaccgccttctatggaataaatcagttttcctatttgtttcctgaagagttt
aaagccatttatttaagaagcaaaccttccaagtttcccagatactcagcagaagtacat
atgtccatccccaatgtgtctttgccgttaagatttgactggagggacaagcaggttgtg
acacaagtgagaaaccagcagatgtgtggaggatgctgggccttcagcgtggtgggggca
gtggaatctgcttatgcaataaaggggaagcccctggaagacctaagtgtccagcaggtc
attgactgttcgtataataattatggctgcaatggaggctctactctcaatgctttgaac
tggttaaacaagatgcaagtaaaactggtgaaagattcagaatatccttttaaagcacaa
aatggtctgtgccattacttttctggttcacattctggattttcaatcaaaggttattct
gcatatgacttcagtgaccaagaagatgaaatggcaaaagcacttcttacctttggccct
ttggtagtcatagtagatgcagtgagctggcaagattatctgggaggcattatacagcat
cactgctctagtggagaagcaaatcatgcagttctcataactgggtttgataaaacagga
agcactccatattggattgtgcggaattcctggggaagttcttggggagtagatggttat
gcccatgtcaaaatgggaagtaatgtttgtggtattgcagattccgtttcttctatattt
gtgtga

DBGET integrated database retrieval system