KEGG   Homo sapiens (human): 151903Help
Entry
151903            CDS       T01001                                 

Gene name
CCDC12
Definition
coiled-coil domain containing 12
Orthology
K12871  
coiled-coil domain-containing protein 12
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    151903 (CCDC12)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    151903 (CCDC12)
 Complex C
    151903 (CCDC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.31
AA seq 166 aa AA seqDB search
MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLR
NYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDV
AKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgactacggctggtgtgggccggctagaggaagaggcgttgcggcgaaaggaa
cggctgaaggccctacgggagaaaaccgggcgcaaggacaaggaagatggggagccaaag
accaagcatctcagagaagaggaggaagaaggcgagaagcacagggaacttaggctgcgg
aactatgtcccggaggatgaggacctgaagaagaggagggtgccccaggccaaaccggtt
gcagtggaggagaaggtgaaggagcagctggaggccgccaagcccgagcccgtcatcgag
gaggtggacctggccaacctcgctcctcggaagcctgactgggacctcaagagagatgtg
gccaagaagctggagaaactaaaaaagcggactcagagggccattgccgagctgatccgt
gaaaggctgaaaggccaggaagacagcctagcctctgcagtggatgctgccaccgaacaa
aagacctgtgactccgactga

DBGET integrated database retrieval system