KEGG   Homo sapiens (human): 1520Help
Entry
1520              CDS       T01001                                 

Gene name
CTSS
Definition
cathepsin S (EC:3.4.22.27)
Orthology
K01368  
cathepsin S [EC:3.4.22.27]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Phagosome
Antigen processing and presentation
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    1520 (CTSS)
   04142 Lysosome
    1520 (CTSS)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    1520 (CTSS)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    1520 (CTSS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.27  cathepsin S
     1520 (CTSS)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   1520 (CTSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q21
AA seq 281 aa AA seqDB search
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDC
STEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTEL
PYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNG
KEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggctggtttgtgtgctcttggtgtgctcctctgcagtggcacagttgcataaa
gatcctaccctggatcaccactggcatctctggaagaaaacctatggcaaacaatacaag
gaaaagaatgaagaagcagtacgacgtctcatctgggaaaagaatctaaagtttgtgatg
cttcacaacctggagcattcaatgggaatgcactcatacgatctgggcatgaaccacctg
ggagacatgggttcttgtggtgcttgctgggctttcagtgctgtgggggccctggaagca
cagctgaagctgaaaacaggaaagctggtgtctctcagtgcccagaacctggtggattgc
tcaactgaaaaatatggaaacaaaggctgcaatggtggcttcatgacaacggctttccag
tacatcattgataacaagggcatcgactcagacgcttcctatccctacaaagccatggat
cagaaatgtcaatatgactcaaaatatcgtgctgccacatgttcaaagtacactgaactt
ccttatggcagagaagatgtcctgaaagaagctgtggccaataaaggcccagtgtctgtt
ggtgtagatgcgcgtcatccttctttcttcctctacagaagtggtgtctactatgaacca
tcctgtactcagaatgtgaatcatggtgtacttgtggttggctatggtgatcttaatggg
aaagaatactggcttgtgaaaaacagctggggccacaactttggtgaagaaggatatatt
cggatggcaagaaataaaggaaatcattgtgggattgctagctttccctcttacccagaa
atctag

DBGET integrated database retrieval system