KEGG   Homo sapiens (human): 1520Help
Entry
1520              CDS       T01001                                 

Gene name
CTSS
Definition
(RefSeq) cathepsin S
  KO
K01368  cathepsin S [EC:3.4.22.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04145  Phagosome
hsa04210  Apoptosis
hsa04612  Antigen processing and presentation
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    1520 (CTSS)
   04142 Lysosome
    1520 (CTSS)
  Cell growth and death
   04210 Apoptosis
    1520 (CTSS)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    1520 (CTSS)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    1520 (CTSS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.27  cathepsin S
     1520 (CTSS)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   1520 (CTSS)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Papain family
   1520 (CTSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 1520
NCBI-ProteinID: NP_004070
OMIM: 116845
HGNC: 2545
Ensembl: ENSG00000163131
Vega: OTTHUMG00000035010
Pharos: P25774(Tchem)
UniProt: P25774
Structure
PDB: 

Jmol
Position
1q21.3
AA seq 331 aa AA seqDB search
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVM
LHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVD
WREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGC
NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKE
AVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggctggtttgtgtgctcttggtgtgctcctctgcagtggcacagttgcataaa
gatcctaccctggatcaccactggcatctctggaagaaaacctatggcaaacaatacaag
gaaaagaatgaagaagcagtacgacgtctcatctgggaaaagaatctaaagtttgtgatg
cttcacaacctggagcattcaatgggaatgcactcatacgatctgggcatgaaccacctg
ggagacatgaccagtgaagaagtgatgtctttgatgagttccctgagagttcccagccag
tggcagagaaatatcacatataagtcaaaccctaatcggatattgcctgattctgtggac
tggagagagaaagggtgtgttactgaagtgaaatatcaaggttcttgtggtgcttgctgg
gctttcagtgctgtgggggccctggaagcacagctgaagctgaaaacaggaaagctggtg
tctctcagtgcccagaacctggtggattgctcaactgaaaaatatggaaacaaaggctgc
aatggtggcttcatgacaacggctttccagtacatcattgataacaagggcatcgactca
gacgcttcctatccctacaaagccatggatcagaaatgtcaatatgactcaaaatatcgt
gctgccacatgttcaaagtacactgaacttccttatggcagagaagatgtcctgaaagaa
gctgtggccaataaaggcccagtgtctgttggtgtagatgcgcgtcatccttctttcttc
ctctacagaagtggtgtctactatgaaccatcctgtactcagaatgtgaatcatggtgta
cttgtggttggctatggtgatcttaatgggaaagaatactggcttgtgaaaaacagctgg
ggccacaactttggtgaagaaggatatattcggatggcaagaaataaaggaaatcattgt
gggattgctagctttccctcttacccagaaatctag

DBGET integrated database retrieval system