KEGG   Homo sapiens (human): 1522Help
Entry
1522              CDS       T01001                                 

Gene name
CTSZ, CTSX
Definition
cathepsin Z (EC:3.4.18.1)
Orthology
K08568  
cathepsin X [EC:3.4.18.1]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    1522 (CTSZ)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.18  Cysteine-type carboxypeptidases
    3.4.18.1  cathepsin X
     1522 (CTSZ)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C1: papain family
   1522 (CTSZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.32
AA seq 303 aa AA seqDB search
MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPA
DLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV
QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECH
AIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN
HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGD
PIV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggcgcgggccagggtggcggccgcttctgctgctcgtgctgctggcgggcgcg
gcgcagggcggcctctacttccgccggggacagacctgctaccggcctctgcggggggac
gggctggctccgctggggcgcagcacatacccccggcctcatgagtacctgtccccagcg
gatctgcccaagagctgggactggcgcaatgtggatggtgtcaactatgccagcatcacc
cggaaccagcacatcccccaatactgcggctcctgctgggcccacgccagcaccagcgct
atggcggatcggatcaacatcaagaggaagggagcgtggccctccaccctcctgtccgtg
cagaacgtcatcgactgcggtaacgctggctcctgtgaagggggtaatgacctgtccgtg
tgggactacgcccaccagcacggcatccctgacgagacctgcaacaactaccaggccaag
gaccaggagtgtgacaagtttaaccaatgtgggacatgcaatgaattcaaagagtgccac
gccatccggaactacaccctctggagggtgggagactacggctccctctctgggagggag
aagatgatggcagaaatctacgcaaatggtcccatcagctgtggaataatggcaacagaa
agactggctaactacaccggaggcatctatgccgaataccaggacaccacatatataaac
catgtcgtttctgtggctgggtggggcatcagtgatgggactgagtactggattgtccgg
aattcatggggtgaaccatggggcgagagaggctggctgaggatcgtgaccagcacctat
aaggatgggaagggcgccagatacaaccttgccatcgaggagcactgtacatttggggac
cccatcgtttaa

DBGET integrated database retrieval system