KEGG   Homo sapiens (human): 1522Help
Entry
1522              CDS       T01001                                 

Gene name
CTSZ, CTSX
Definition
cathepsin Z (EC:3.4.18.1)
Orthology
K08568  
cathepsin X [EC:3.4.18.1]
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.32
AA seq 303 aa AA seqDB search
MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPA
DLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSV
QNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECH
AIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYIN
HVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGD
PIV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggcgcgggccagggtggcggccgcttctgctgctcgtgctgctggcgggcgcg
gcgcagggcggcctctacttccgccggggacagacctgctaccggcctctgcggggggac
gggctggctccgctggggcgcagcacatacccccggcctcatgagtacctgtccccagcg
gatctgcccaagagctgggactggcgcaatgtggatggtgtcaactatgccagcatcacc
cggaaccagcacatcccccaatactgcggctcctgctgggcccacgccagcaccagcgct
atggcggatcggatcaacatcaagaggaagggagcgtggccctccaccctcctgtccgtg
cagaacgtcatcgactgcggtaacgctggctcctgtgaagggggtaatgacctgtccgtg
tgggactacgcccaccagcacggcatccctgacgagacctgcaacaactaccaggccaag
gaccaggagtgtgacaagtttaaccaatgtgggacatgcaatgaattcaaagagtgccac
gccatccggaactacaccctctggagggtgggagactacggctccctctctgggagggag
aagatgatggcagaaatctacgcaaatggtcccatcagctgtggaataatggcaacagaa
agactggctaactacaccggaggcatctatgccgaataccaggacaccacatatataaac
catgtcgtttctgtggctgggtggggcatcagtgatgggactgagtactggattgtccgg
aattcatggggtgaaccatggggcgagagaggctggctgaggatcgtgaccagcacctat
aaggatgggaagggcgccagatacaaccttgccatcgaggagcactgtacatttggggac
cccatcgtttaa

DBGET integrated database retrieval system