KEGG   Homo sapiens (human): 1525Help
Entry
1525              CDS       T01001                                 

Gene name
CXADR, CAR, CAR4/6, HCAR
Definition
(RefSeq) coxsackie virus and adenovirus receptor
  KO
K06788  
coxsackievirus and adenovirus receptor
Organism
hsa  Homo sapiens (human)
Pathway
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cardiovascular diseases
   05416 Viral myocarditis
    1525 (CXADR)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Others
   CXADR, CAR; coxsackievirus and adenovirus receptor [KO:K06788]
    1525 (CXADR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
21q21.1
AA seq 365 aa AA seqDB search
MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLIS
PADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQC
KVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSD
SQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIA
GAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS
SLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSK
DGSIV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcctgctgtgcttcgtgctcctgtgcggagtagtggatttcgccagaagtttg
agtatcactactcctgaagagatgattgaaaaagccaaaggggaaactgcctatctgcca
tgcaaatttacgcttagtcccgaagaccagggaccgctggacatcgagtggctgatatca
ccagctgataatcagaaggtggatcaagtgattattttatattctggagacaaaatttat
gatgactactatccagatctgaaaggccgagtacattttacgagtaatgatctcaaatct
ggtgatgcatcaataaatgtaacgaatttacaactgtcagatattggcacatatcagtgc
aaagtgaaaaaagctcctggtgttgcaaataagaagattcatctggtagttcttgttaag
ccttcaggtgcgagatgttacgttgatggatctgaagaaattggaagtgactttaagata
aaatgtgaaccaaaagaaggttcacttccattacagtatgagtggcaaaaattgtctgac
tcacagaaaatgcccacttcatggttagcagaaatgacttcatctgttatatctgtaaaa
aatgcctcttctgagtactctgggacatacagctgtacagtcagaaacagagtgggctct
gatcagtgcctgttgcgtctaaacgttgtccctccttcaaataaagctggactaattgca
ggagccattataggaactttgcttgctctagcgctcattggtcttatcatcttttgctgt
cgtaaaaagcgcagagaagaaaaatatgaaaaggaagttcatcacgatatcagggaagat
gtgccacctccaaagagccgtacgtccactgccagaagctacatcggcagtaatcattca
tccctggggtccatgtctccttccaacatggaaggatattccaagactcagtataaccaa
gtaccaagtgaagactttgaacgcactcctcagagtccgactctcccacctgctaaggta
gctgcccctaatctaagtcgaatgggtgcgattcctgtgatgattccagcacagagcaag
gatgggtctatagtatag

DBGET integrated database retrieval system